CAZyme Information: MGYG000000530_00835

Basic Information

• Species: PeH17 sp000435055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; PeH17; PeH17 sp000435055
• CAZyme ID: MGYG000000530_00835
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		41640.88	5.0421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000530	1956406	MAG	Fiji	Oceania

• Gene Location: Start: 40524; End: 41615 Strand: +

Full Sequence      

MEGYKVCVYAIAKDEAKFAARWAESMSEADAVYVLDTGSSDDTVKILQAHGVNVRSEIIT
PWRFDAARNRSLELVPEDADICVCTDIDEVLHPGWRKAAEKAWSNGADMLRYRYTWNFNE
DGSEGTVFYIDKIHARHGFKWVNPVHEVLEYEGEGSFRHIIAEGIQLDHLADASKSRAQY
LPLLEMSVRENPENDRNMHYLGREYMFYGRWNDCIATLKRHLEMKSAVWRDERSASMRFI
ARACTALNDIAEAESWLYRAAAEAPYLREPWIELAGNAYARQDFEGTLYFALKALAIETR
PKTYITEPAAWGAAPYDYASLGYFYTGRKKEALIMAEKAVEKEPENERLRANRDIIAQLS
ETL

Enzyme Prediction     

No EC number prediction in MGYG000000530_00835.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	4.68e-11	5	154	1	152	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd00761	Glyco_tranf_GTA_type	4.92e-05	12	95	5	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	6.30e-04	5	243	4	238	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	0.002	32	122	30	126	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	0.007	15	95	66	154	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA29496.1	7.93e-153	5	357	2	355
ANU42689.1	3.72e-151	5	357	2	355
QQR04409.1	3.72e-151	5	357	2	355
AQS58819.1	1.50e-131	1	356	1	356
AQS58818.1	7.49e-129	1	361	1	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000530_00835.