CAZyme Information: MGYG000000530_01133

Basic Information

• Species: PeH17 sp000435055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; PeH17; PeH17 sp000435055
• CAZyme ID: MGYG000000530_01133
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000530_26|CGC1	39293.6	9.5057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000530	1956406	MAG	Fiji	Oceania

• Gene Location: Start: 28543; End: 29628 Strand: +

Full Sequence      

MSKCIILTGGGSAGHVTPNIALLPYLRAQGCEIHYIGLAGSIEEKLISEQRDVKFHAIES
GKFRRYFSLKNLSDPFKVLKGISQSKKLMKSLQPDVVFSKGGFVSVPVVIAAKGKTTVIC
HESDYTPGLANRIAGRFADTICVTFEDTLEHLGKKRSAAVHTGTPIRRELFSGKRERGLQ
FLGFDGKKPIILIIGGSLGAAALNDGVRAALPKLTKQFDIVHLCGKGKLDESVNCPGYRQ
YEYIGRELPDLLAATELVVSRAGANAVFEFLALGIPALLVPLPLGASRGDQILNAEYVRK
KGYAAVLPQEELTPEVLVDRVNELYASRETYRANMKADPTLDGTQEVMTVIMNAINKKNT
H

Enzyme Prediction     

No EC number prediction in MGYG000000530_01133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	337	1.4e-40	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	3.47e-143	2	351	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	2.20e-137	2	357	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.67e-116	5	337	2	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.96e-112	3	357	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	3.41e-41	5	141	1	137	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97137.1	4.44e-132	3	357	2	355
QBE95596.1	2.38e-129	3	357	2	355
AMJ42263.1	4.99e-128	3	351	2	349
AYH40137.1	7.31e-128	1	358	1	353
QMW76520.1	7.83e-128	3	357	2	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	4.25e-41	3	351	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	3.37e-37	1	351	1	348	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	8.11e-29	3	330	7	326	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q812T8	2.16e-125	3	353	2	348	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG2 PE=3 SV=1
Q730T5	3.06e-125	3	351	2	346	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG2 PE=3 SV=1
Q893R7	3.74e-125	1	359	1	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
Q6HDR3	6.14e-125	3	351	2	346	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=murG2 PE=3 SV=1
Q81JE6	8.71e-125	3	351	2	346	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus anthracis OX=1392 GN=murG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000530_01133.