CAZyme Information: MGYG000000532_00013

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_00013
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000000532_1|CGC1	35881.6	9.5253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 15270; End: 16238 Strand: -

Full Sequence      

MKTTIVIPNYNGISYLRECVKSLREDLKNHPAAVIIVDNGSGDGSVEWIKQECPDITLIP
LKKNTGFPHAVNVGIRHAKTPFVLLLNNDTVVRPGFTKALEEAISGHKDAFSVSAKMLSM
KEEGIMDNAGDLYCALGWAFARGKDRPAEDYNKPCEIFSACGGAAIYRKSVFEKIGYFDD
SHFAYLEDVDIGWRAKIYGYRNFYEPKAEVLHAGSAASGSRYNAFKVSLSSANSVAIIGK
NMPLLQIIVNLPFLLPGFLVKFLFFVRKGYGKIYAAGCLKGFMRGFTEDGRKKKVYVLPE
NLGNYMRIQLVLWGNLFKRFAN

Enzyme Prediction     

No EC number prediction in MGYG000000532_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	176	1.4e-27	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	2.91e-54	1	268	3	282	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.70e-53	5	212	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.43e-23	5	204	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.88e-23	4	172	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	5.91e-19	4	204	1	185	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02103.1	1.55e-125	4	318	5	322
QOV20102.1	1.30e-115	2	321	3	321
CBL24567.1	4.02e-111	1	320	1	315
QYX28909.1	2.53e-109	1	317	1	312
QBF76188.1	3.58e-109	1	317	1	312

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	3.89e-16	5	219	7	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.89e-16	5	219	7	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	6.73e-09	4	268	21	282	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
Q9ZDI9	2.40e-07	4	194	11	192	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
O06483	7.12e-06	1	89	1	91	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
244	266