CAZyme Information: MGYG000000532_00016

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_00016
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000000532_1|CGC1	74626.7	6.778

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 19516; End: 21474 Strand: -

Full Sequence      

MDYKEAYEKEHLKNAELAGRVADLEMQKEDLSYKLDRIKNNPLFKASKPARNVMHWAIRQ
KNRLAGCGGPKGVVRKLKQKKQEKSVMRSYGTDSFPTPEEAKKERETVFERPVKVSILVP
LYNTPKEFLTAMIDSVLAQTYENWELCLADGSDEAHKEVGEICATYVEKEGDRKRIRYEK
LAENKGISGNTNACYAMSTGEYIGLFDHDDILHPSALYEYVKAINEQGADYIYCDETTFK
NGDINKMLTMHFKPDYAIDNLRANNYICHFSVFARKLLDGTELFRSQFDGSQDHDMILRL
TDKAEKIVHIPRLLYYWRCHAGSVASGIEAKTYAIEAAKGAVADHLRKHGFRNFKIESTR
AFETIFRIRYEVLGNPKISIIIPNKDHVTDLRRAVTSILEKSTYDNYEIIIVENNSETEE
IFRYYDELKKNEKIKIVTYEGGFNYSAINNLGVSRADGDYVLLLNNDTEVITVNWMEELL
MYAQREDVGAVGCKLYYADRTIQHAGVVIGLGAHRTAGHSHYRMPRQNLGYMGRLCYAQD
VSAVTGACLLVKKSLYEAVEGLDEGFAVSLNDVDFCLKLREKGLLNVFTPFAELYHYESV
SRGLDTDGEKAARYNAESAKFREKWKEVLEKGDPYYNPNFSLDRSDFALKIR

Enzyme Prediction     

No EC number prediction in MGYG000000532_00016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	116	277	3.6e-24	0.9647058823529412
GT2	379	523	3.9e-21	0.7764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.15e-82	114	319	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.00e-39	380	598	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.52e-28	374	603	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.92e-21	116	278	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.56e-20	116	323	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02106.1	0.0	1	650	4	678
ADL33299.1	0.0	1	651	4	673
AOZ95572.1	0.0	1	651	4	675
QUO22278.1	4.09e-290	34	651	17	630
CAB1243278.1	4.95e-243	3	650	385	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.12e-123	115	649	368	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.15e-83	101	650	307	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	6.43e-15	115	467	15	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	2.09e-13	115	467	16	381	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	2.77e-13	115	467	16	381	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000004	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000532_00016.