CAZyme Information: MGYG000000532_00017

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_00017
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000000532_1|CGC1	71905.03	5.9813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 21496; End: 23436 Strand: -

Full Sequence      

MGIKSFLKQGMAYGLDRQYEKKCASRKILYKDWVASMEEAEAGADGSRTEAASEKPGTGA
GAPSSGERAEAVFFSNTEAGAWADGAKERAEAFLSAHPEICVVYGDEDVETAPGQYENPW
LKPCWSPDTYLWKDYLGEAVAVRKSFYEKAEEKSRDGLLKAAGGFTKGCQSIAHINGILF
HRKTDWFTGEANEKTNGGMNAETNGSVTWEQTAGGQADCRDAKKQGTPYISVIIPSKDNA
VVLKKCLDTLKKTAADISYEVLLVDNGSGEAVKKKIEEMTADAPDIHYIYEPMEFNFSRM
CNLGAERAKGSLLLFLNDDIEATHTGWLSDMAKLAERPHVGAVGCKLLYPDTDKIQHAGI
TNLPMGPVHKLQFLRDNKCYYDNRNRGIRNVSAVTAACLMVRREVFEEAGGFCESMQVAF
NDVDFCFTLLEKGYYNAVCNHIHLLHHESLSRGADESEEKLKRLHRERTMLYDRHPGLNG
KDPFYHDWLNRTGLDTRIQPAYQSGREIVDVQAAKEVAKESNEAYVLKNARKDRCLLVRI
EAADASHISGYGVVLGSDNACFNGKLLLERKGRQPAVYELDFTEQYRQDLQENMPDQKNV
ALCGFHVNIAEPLPEGEYRIGMLATDKISGSSLMNYSNRTFIVART

Enzyme Prediction     

No EC number prediction in MGYG000000532_00017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	231	408	1.1e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.96e-36	232	448	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.79e-25	226	472	1	242	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.93e-18	231	406	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.31e-16	232	434	1	152	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	1.18e-12	94	184	108	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02107.1	4.97e-161	1	639	1	663
ADL33298.1	2.32e-114	86	636	103	695
AOZ95571.1	9.55e-113	86	636	103	694
QWT52131.1	2.64e-86	94	620	503	1034
CBK92935.1	1.07e-85	94	627	165	699

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	2.95e-47	88	544	421	885	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	2.39e-42	94	486	473	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
D4GYG7	1.65e-09	228	434	6	196	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
P46370	3.11e-06	215	434	117	317	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000532_00017.