CAZyme Information: MGYG000000532_01206

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_01206
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000532_8|CGC3	42755.72	3.9164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 55783; End: 56925 Strand: -

Full Sequence      

MIMKKRLLALLCALTLAVGTAACATSGSGENETNEQQTEDNNNTGNTQQTEDAAGSTDAG
DAAENAVYTPGVLSNPDASEAAQDLFTYICDTYGNAILSGQQESTWMGSEQYEFDYIYDN
TGKYPAIRGLDYMNDDFDGVNRRAKEWYDRGGIVTICWHCGSDFSGSWSECMNTTITDWD
KALTEGTPEYETLIKGMDKAAEALQELKEENIPVLWRPFHEFDGAWFWWGKGGSENFKKL
WVMMYDRYNNYWGLDNLIWVLGYSGNGNGYADWYPGDAYVDIAGADSYNDGSNAALYNKV
KDVVGEERPICFHECGRIPTVDQLTTTNAGWVWFMTWHTEYITDHNDTDTLNEIYNDDYV
ITLDELPDLYNTKENPAAEK

Enzyme Prediction     

No EC number prediction in MGYG000000532_01206.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	74	365	3.7e-95	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.69e-52	75	365	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.87e-18	168	290	138	258	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	6.28e-126	73	371	167	464
BCN30282.1	1.75e-113	73	367	6	297
AWB26443.1	6.53e-76	73	369	48	339
AEK42302.1	2.92e-75	75	369	154	446
AGT84366.1	2.92e-75	75	369	154	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.58e-52	73	366	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	1.83e-49	73	380	45	338	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	5.62e-44	75	366	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	3.58e-43	76	367	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	1.91e-42	75	366	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.03e-50	73	366	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.50e-50	70	379	143	475	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55297	1.18e-42	73	367	158	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	1.59e-42	73	367	156	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	1.58e-40	73	367	157	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000513	0.999516	0.000000	0.000001	0.000000

TMHMM  Annotations     

start	end
7	29