CAZyme Information: MGYG000000532_01207

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_01207
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	MGYG000000532_8|CGC3	47002.03	6.6584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 57013; End: 58251 Strand: -

Full Sequence      

MRVTAVAVGTRGDVNPLVELGMEMKKRGHEFRILTHEKFRPMIEEKGVTYLHLDGNADHV
MQYMVTDYKTSADFMKGLMKLKKESPAFMEQTMEAVQGSDLIMYGTCGAFARHAAEYYHI
PCARYFYSPMDKTDKYSLYSEEYDSPKVGKTYNSLYSGMSMLTKIMMNKWRKSVGLPKWK
MSDRYPVMDGRHLLTFYPVSPQLMPPDTSWDKDTYVTGYWYHPAEDAAQYEMPDSLRAFL
AKGEKPIFIAFGKAESEELAELQERTLTAAKMAGIRAIIQADQIKEVEKVNTEKLYFIDT
VPYSYIFPYVRGVVHHGGCTTNGLSLLYGCPTLVIPLALDQYFYGRMDNRLGAGPEPLYI
RKKLCTTEQIESALLDLVSGQYDEAAREISAKMQRENGVTCAADAIEEYVRR

Enzyme Prediction     

No EC number prediction in MGYG000000532_01207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	191	410	6.7e-26	0.4869109947643979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.05e-46	1	409	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	5.72e-36	1	412	2	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	1.53e-13	12	412	7	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	1.49e-05	3	56	1	56	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95283.1	2.83e-196	1	410	1	410
QTE68307.1	2.41e-67	1	412	1	413
QAT48736.1	3.65e-65	1	412	65	475
CAB1252917.1	5.82e-63	1	358	1	359
QAT62528.1	6.88e-59	1	411	1	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.94e-39	6	411	25	443	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.27e-39	6	411	45	463	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1RRV_A	1.64e-17	1	412	1	401	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
1PN3_A	3.16e-14	1	354	1	335	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]
1IIR_A	4.50e-13	1	412	1	400	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7KAK6	1.39e-48	2	411	789	1207	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1
Q5A950	1.80e-44	3	406	1017	1429	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
Q9Y751	6.32e-43	6	402	766	1170	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
Q6BN88	2.30e-42	4	411	1051	1473	Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ATG26 PE=3 SV=2
Q6C8M8	3.05e-42	1	406	995	1409	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000532_01207.