CAZyme Information: MGYG000000532_01910

Basic Information

• Species: CAG-510 sp000434615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp000434615
• CAZyme ID: MGYG000000532_01910
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000532_18|CGC1	35030.57	5.405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000532	2771736	MAG	Fiji	Oceania

• Gene Location: Start: 15359; End: 16273 Strand: -

Full Sequence      

MENHTAMLTDLSATVRTKHLYDFLLSLKGKGILSGQQECPCDKTHGDELAHIKECSGHLP
AILGLDYIEHDYEGVNKRAREWFDRGGIVSICWHWGIPPYGVGYPSSQESVDMVELLTPG
TPLYEGLLSNLDVVANALKELQDADIPVLFRPLHEFDGAWFWWGKGGPEAFGRLWRLMYD
RYVNFHGLHNLIWVLGYSHELHEGWYPGDDVVDVIGGDAYSEGIHEELYHFLEHQTTKHM
PICHHENGPIPDPAEMIAKKVDWCWFLTWHTIHIHEQNTPEYIHYIYNHPYVITLESLPS
YYKA

Enzyme Prediction     

No EC number prediction in MGYG000000532_01910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	12	296	9.6e-84	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.40e-53	10	294	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	3.54e-14	129	221	162	257	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	5.19e-137	8	300	6	298
ADU20874.1	7.71e-90	3	302	162	463
AJP70762.1	1.86e-86	5	298	19	318
AOW25662.1	1.01e-81	13	298	6	294
ATC26721.1	5.46e-79	12	300	5	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	8.77e-53	13	298	11	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	2.05e-50	8	298	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	5.54e-49	12	298	27	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.27e-44	12	300	38	354	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	6.30e-38	13	301	50	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.54e-55	8	298	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	4.14e-54	6	300	144	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.25e-47	10	295	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	7.86e-41	8	301	157	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
Q5AWB7	1.73e-39	18	298	38	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000532_01910.