CAZyme Information: MGYG000000533_00318

Basic Information

• Species: Phascolarctobacterium_A sp900551335
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900551335
• CAZyme ID: MGYG000000533_00318
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		24562.17	9.3791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000533	2190020	MAG	Fiji	Oceania

• Gene Location: Start: 9299; End: 9925 Strand: +

Full Sequence      

MAVARRRRRRSAKSRLRRLLVLLAAFCLLCFGGWKLWSSDAVQMRFVYMWDYQQDIITYS
QKNNVDPFLVAAIIKNESNFKHKAVSGVGAVGLMQIMPDTGRWIAEQMGLKNYQDSDLYT
TKTNIRMGCWYVGELEHEFQQNMTLVMIAYNAGRGQTHEWMQENNWTYDFNDVQAIPFPD
TREYVAKVLHDRDKYYLLYKDRLNNKSE

Enzyme Prediction     

No EC number prediction in MGYG000000533_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	193	2.6e-26	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.16e-76	50	194	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.33e-51	52	202	6	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.26e-33	67	189	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.63e-31	51	206	138	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.20e-26	56	166	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	1.39e-115	16	203	18	205
BBG64618.1	2.08e-95	3	203	1	198
QNP77119.1	6.10e-95	1	203	10	209
ADB46849.1	1.69e-65	26	205	19	198
AEQ23289.1	1.16e-60	23	199	17	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.65e-25	48	199	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.67e-25	48	199	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.69e-25	48	199	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.70e-25	48	199	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.72e-25	48	199	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.25e-16	35	196	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	2.53e-15	48	194	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.53e-15	48	194	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P44888	3.81e-15	61	204	437	580	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC3	9.73e-15	35	196	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999945	0.000052	0.000009	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
19	38