CAZyme Information: MGYG000000534_00058

Basic Information

• Species: Prevotella sp900543975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543975
• CAZyme ID: MGYG000000534_00058
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000534_1|CGC2	42714.62	8.8782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000534	3142227	MAG	Fiji	Oceania

• Gene Location: Start: 71703; End: 72845 Strand: +

Full Sequence      

MLKANNFKQLEGKRVGLVTNPTGVDNFMKSDIDILHEAKNVKLVALFGPEHGVRGSVHAG
DHVGNAADPTTGVPVYSLYGKSRIPSKEMLQGIDVLIYDIQDIGCRSFTYISTLGNIMKA
AAENGIKVMVLDRPNPLGGLKVEGNLAEDDCLSFVSAFKIPYVYGLTPGEVALLLNGENM
LGKKCDLEVVKMKGWKRKMTYEQTGLQWVLPSPHIPQPVSAPFYSVSGIVGELDSISIGV
GYTLPFQMFGAPWIKAPELAQRLNALNLPGVMFRPMYYKPFYAFGKGEELQGVQVYLTDY
EKAKLTSIQFYVLQELYSLYPDHDVLAKCTKRHDMFDKVCGSKQIRQLFMKRHKWEDVQA
YWDKDAEAFKKLSKKYWLYK

Enzyme Prediction     

No EC number prediction in MGYG000000534_00058.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	15	379	6.1e-130	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	0.0	16	379	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	9.66e-146	2	379	33	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73953.1	1.60e-196	1	380	32	412
QKH85440.1	1.56e-192	1	380	44	424
ADV42425.1	3.00e-192	1	380	31	413
QDO67929.1	5.43e-192	1	380	30	410
QPH58392.1	6.05e-192	1	380	31	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.51e-178	1	380	19	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	1.06e-48	7	379	17	368	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.39e-107	8	379	50	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000534_00058.