CAZyme Information: MGYG000000534_00219

Basic Information

• Species: Prevotella sp900543975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543975
• CAZyme ID: MGYG000000534_00219
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000534_2|CGC1	43621.07	6.7653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000534	3142227	MAG	Fiji	Oceania

• Gene Location: Start: 91691; End: 92845 Strand: +

Full Sequence      

MRNKRGSVLCLGLVAAMMLFASSLQALPLTSQVYAYTINWSAAADSATQSLVNRFWDVDK
HYFVYNADQFENAPTNAYWPQAHAMDVIIDAYLRTGDKKYSDMFPLWYEGIKQQNSYDHN
GYRNNFYDDSEWIGLTMVRLYEVTKEDKYLATAKDLMEWVKTAWNNIGGGGIAWEKNENL
HSKNACSNGPAALLAVRLYEVTKDADYLEWSKKIYNWEKEHLFNPATGAVYDALNGNTGK
LDKVTLSYNSGTFTGAAYHLFKVTGDETYLNDARKCANFAISDRSMIDTSNNIIRDEGKT
DGGLFKGIFMRYFRQLLDEPALGEVYRKKFTTFFNHNAEVLWRNGVNKNDLLFSPSWSTP
VVGTTTLTSHVSGCTLLEMRASHK

Enzyme Prediction     

No EC number prediction in MGYG000000534_00219.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	48	362	1.9e-85	0.8715083798882681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.44e-53	40	343	2	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	8.53e-43	40	381	3	350	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.52e-10	44	231	2	174	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.28e-07	79	233	36	182	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	4.45e-06	133	278	148	276	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30005.1	7.31e-152	36	381	31	370
BBK86488.1	7.31e-152	36	381	31	370
QUT65780.1	7.31e-152	36	381	31	370
QMI79910.1	7.31e-152	36	381	31	370
QBJ18505.1	7.31e-152	36	381	31	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	3.42e-74	78	381	88	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.09e-72	78	381	89	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	8.55e-72	78	381	89	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	1.15e-45	40	381	3	338	ChainA, Lin0763 protein [Listeria innocua]
5M77_A	1.45e-37	30	358	30	352	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q75DG6	7.20e-11	78	321	65	324	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000368	0.998872	0.000200	0.000195	0.000164	0.000157

TMHMM  Annotations     

start	end
7	29