CAZyme Information: MGYG000000534_00336

Basic Information

• Species: Prevotella sp900543975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543975
• CAZyme ID: MGYG000000534_00336
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	MGYG000000534_3|CGC2	77256.83	7.4339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000534	3142227	MAG	Fiji	Oceania

• Gene Location: Start: 84626; End: 86674 Strand: +

Full Sequence      

MNNIFQSLLSTVAFALCAGTLQAQPVTCRVVDRPDNTALSYNYTNARTPLRQQHFIKLPV
GSIRPAGWVGRYLQLQRDGLTGHLGEISAWLDKHNNAWLTKGGDHGWEEVPYWLKGYSDL
AYILNDKAMLAETKSWIEAILKSQREDGAFGPVNMRGDKPELWAQMIVLSTLQTYYEHSG
DERVLKLMTNYFRWQMTIPDDKFLEDYWENSRGGDNLYSVLWLYNRTGDKFLLDLAHKIH
RNTANWTNPTSLPNWHNVNIAECFREPATYYMLTGDPKMLHASYNVQSLVRRTFGQVPGG
MFGADENARMGYIDPRQGVECCGMVEQMASDEIMLRFTGDPAWADNCEDVAFNTFPASVM
PDFKALRYITSPNMVQSDSKNHNPGIDNSGPFLSMNPFSSRCCQHNHAQGWPYYSENLIY
ATPDNGIAAVIYGACTADVKVADGKKVTVSEVTNYPFDENIAFTIDKGKAAFPFYVRIPK
WTRGAEVCVNGERVDARLMGGKYLVVNREWKKGDKLTLRFPMHLSMRVWQVNKHSVSVDY
GPLTLSLKIKERYVQRDSKETAIADSKWQKNADASQWPTTEIYADSPWNYALCLRGFGRK
ALNNIEVVKKPWPADNFPFTLESVPLEFKAKGRRVPSWTIDETGLCGVLPDETAVKAKEV
EDITLVPMGAARLRISAFPVAR

Enzyme Prediction     

No EC number prediction in MGYG000000534_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	175	545	3.9e-33	0.7216699801192843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.77e-128	29	546	3	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.58e-24	106	547	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07470	Glyco_hydro_88	5.43e-04	90	243	9	164	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADJ45365.1	3.74e-167	18	681	10	662
AFO77076.1	3.74e-167	18	681	10	662
AEK42125.1	3.74e-167	18	681	10	662
AGT84204.1	3.74e-167	18	681	10	662
QKW18167.1	1.36e-165	49	679	57	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.11e-15	320	548	333	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.89e-14	320	548	333	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	7.77e-14	219	541	198	533	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	2.74e-13	317	546	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.89e-12	317	546	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001058	0.908780	0.089245	0.000361	0.000261	0.000245

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000534_00336.