CAZyme Information: MGYG000000534_01215

Basic Information

• Species: Prevotella sp900543975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543975
• CAZyme ID: MGYG000000534_01215
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000534_19|CGC1	45837.31	9.1874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000534	3142227	MAG	Fiji	Oceania

• Gene Location: Start: 35263; End: 36483 Strand: +

Full Sequence      

MCLELMYLRNLLILSALLFVTACARKQQAVTTPWGETIGDEEGDTAVVAQNFSYNDILDA
GEIIMLTMSGPDSYFDYHGRAMGTQYLLCERFAQKIGVSVRVEVCKDTADMIKKLQNGDG
DIIVWQLARKQTKGLLACGASTDSTSWVVRRDSKQLADSLRGWYRPALLAQVKKEERYAF
STANVRRHVYAPMLNAAKGEISSYDHYFKMYAAACRWDWRLMAAQCYQESTFDPKAYSWA
GARGLMQIMPSTAASLGLSEGEMYNPEANIAAAARYIVKLNGLFSDVRSYDERINFVLAS
YNGGHFHVRDAMALARKNGRNPYRWADVADYVLKLTQPAYYNDPVVKYGYMRGTETVDYV
ARIRSRWEQYCGKVKGGGGIGTHFNMGGGNYEPRKAQRKNRFKIKE

Enzyme Prediction     

No EC number prediction in MGYG000000534_01215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	216	368	2.8e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.92e-75	208	371	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.52e-49	8	364	5	444	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.39e-45	33	364	4	425	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	9.43e-26	212	323	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.56e-22	220	368	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	2.24e-160	8	404	36	433
ALO48082.1	5.66e-158	6	404	1	391
AGB28026.1	2.29e-155	20	379	38	394
QUB48180.1	1.70e-152	7	404	5	392
QNT65891.1	3.50e-151	14	388	10	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.02e-24	204	368	259	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.09e-24	204	368	266	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.09e-24	204	368	266	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	2.33e-24	204	368	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.33e-24	204	368	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KTN5	2.33e-27	102	375	189	466	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltF PE=3 SV=1
A5F353	2.33e-27	102	375	189	466	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=mltF PE=3 SV=1
Q87RW1	4.16e-27	107	374	199	470	Membrane-bound lytic murein transglycosylase F OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=mltF PE=3 SV=2
A8ZWR8	7.91e-27	218	368	300	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
B0KRE9	1.05e-26	201	368	286	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000013	1.000036	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000534_01215.