CAZyme Information: MGYG000000534_02101

Basic Information

• Species: Prevotella sp900543975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543975
• CAZyme ID: MGYG000000534_02101
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36989.43	10.1089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000534	3142227	MAG	Fiji	Oceania

• Gene Location: Start: 4536; End: 5492 Strand: +

Full Sequence      

MTKPHILALSRLYPCLAWFAACLLFFTSVSANAQMRWNQAYQQYVDQYKDLAIEQMLRYN
IPASITLAQGLFESRAGQSVLATQGNNHFGIKCHGWGGRTMYHDDDERGECFRAYENAYQ
SFEDHSKFLARNTRYARLFSLKKTDYKGWARGLKACGYATNPQYANKLIGIIELYKLNKF
DHATSYDKFMATHTSKDKALPGQRLHPIKIYNDNYYLVARQGDTFKKIGKEVGISYRAIA
KHNERHWKDRIEPGDIIYLKKKRKKAIKAYKNRPHIVKDGESMYSIAQTYAIRLKSLYKK
NHLSPDYQIKVGDTLRVY

Enzyme Prediction     

No EC number prediction in MGYG000000534_02101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	50	177	2.8e-33	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.87e-35	42	186	44	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.85e-31	42	181	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	3.22e-29	34	181	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.18e-25	49	177	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	6.22e-17	61	172	172	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO49150.1	9.48e-154	32	318	18	305
VEH15664.1	1.62e-152	23	318	10	306
AGB29226.1	3.86e-149	31	318	20	308
BCS86660.1	3.63e-147	33	318	2	288
ADE83099.1	4.79e-144	19	317	4	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.13e-12	42	172	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.12e-12	42	172	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.01e-11	42	172	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	8.76e-08	60	214	79	245	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.64e-07	61	182	23	155	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.98e-16	58	200	65	218	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.01e-09	42	171	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q2G222	6.73e-07	60	214	339	505	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P58231	7.34e-07	61	176	169	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	7.34e-07	61	176	169	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001409	0.996516	0.001270	0.000280	0.000246	0.000248

TMHMM  Annotations     

start	end
7	29