CAZyme Information: MGYG000000535_00178

Basic Information

• Species: Olsenella sp900538935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp900538935
• CAZyme ID: MGYG000000535_00178
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		44103.89	6.9682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000535	2249918	MAG	Fiji	Oceania

• Gene Location: Start: 88638; End: 89822 Strand: -

Full Sequence      

MVRRGEGAAVVSWLVVVARTKDAIAHFASSGAVILENKGRSCDDWGFMSDRALHGVNLSG
WLTLEPWVSPVLFADSGALDEESLVRSLGKRHYRDLVSEHRADFIKQTDFVHIAARGFNA
VRLPVPWYVFGDDGPEAGPFLGCIEKVDKAFDWADEISLNLVLVLDIAPGSASDQTSLVR
NHDDFSHYRNDMVSVLGMLAKRYATRASFAGIEVADDPAVQVRHGLTLTDGVPIHRLRNY
YRDAYDVIRREAGDDVRVIIPDAGEPASWRHFMAHDRYKNVWLDCHLYHYTDSVKTAGPS
GVRSLVNKSQKSLRAARRSGLPVMVGKWSAALPFSDSMTTPEGRIALERVYISEQLNAFR
DCDGWFYQTWKTDGKLSSWDARVSLASFERRMLA

Enzyme Prediction     

No EC number prediction in MGYG000000535_00178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	100	370	1.5e-47	0.9900662251655629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	9.95e-13	49	275	14	240	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.82e-04	104	328	24	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR87855.1	5.99e-256	48	394	1	347
ADK68544.1	5.99e-175	48	393	1	346
AKT48931.1	1.02e-163	48	393	1	345
QOY61077.1	2.85e-149	48	393	1	346
QUC04868.1	4.20e-138	53	393	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.14e-39	53	371	3	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.20e-39	53	371	3	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.50e-22	53	382	13	382	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
3N9K_A	2.67e-21	45	373	7	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	3.46e-21	45	373	2	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XN12	6.36e-33	53	387	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
A1CRV0	1.20e-32	53	387	42	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
A1D4Q5	1.68e-32	53	387	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
Q4WK60	6.08e-32	53	387	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A2RAR6	3.04e-31	51	387	40	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999995	0.000040	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000535_00178.