CAZyme Information: MGYG000000535_01031

Basic Information

• Species: Olsenella sp900538935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp900538935
• CAZyme ID: MGYG000000535_01031
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
928		98702.75	4.7494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000535	2249918	MAG	Fiji	Oceania

• Gene Location: Start: 24149; End: 26935 Strand: -

Full Sequence      

MRAMVKGRFESLALVALVSTLLAAACALCAVSAYGEEAPSASAHDVADITFRLEKDAPAT
GAANEEQEWRKVTTVSGASELATVGDDAADSDGTSFSYVEFGGEDRDKIELSIKAGDSSW
SEWTGGDSERGQVSDGDAPVQCVRLRLASDDVSEYAIAYRVHVAGSGWLGWCADGDVAGC
ETDGAVVDDLEVVFVKRSEGNELATFLSGQEKAAYDGSEDVGDATEANRANAVDSDDSST
STGLPAARPSASSAVTASVSYRAHVQNIGWQSYVSDGETAGTTGRGLRVEALSLGVAGVS
GGIRYRAHVQNIGWQGWHADGEDCGTTGKGLRVEALQVELTGTASANYDVYYRTHVQNVG
WTSWSKNGATSGTTGRGLRVEAVQVLLVSHGQAIPTGDGAAYSKLANTTYSSPTIRYQAH
VQSVGWQAETNDGNMAGTQGRSLRLEALRASVAGASGGIQYRAHVQNIGWQRWEKDGAIA
GTEGQGLRMEALEVQLTGAITSSYDVYYRVHVSDIGWMAWAKNGDTSGTVGLGRRIEAVQ
MKLVKKGSPAPSGEGEKASYPSIYAPEITYATSSVGGDWQTTVKDGEVSGTTGKSLSVGR
LRAQLSSPSSYGGIKYQVSTDGTDWSDAVSDGGDAGVSGSALKAVRLSLTGAAAKYCDVW
YRVHVSSIGWLGWTRNGCDAGTEISSNAIEAIQVVVKLKGSSAPGSTVKPFAYQDLLNGI
DIASHQAGIDVANVSADFVFIKATQGTWYKNQLPSKGYDYAAWGDKTLASGRLLGFYHYA
EGGDPVKEAEYFYNAIKTYKGRAVVALDWEGQDNELFGTGFDVQWCKRFLDRIAELMEAK
PLIYMSKSTTRKYDWSSVAASYPLWVAQYASNNTTGYQSNPWTDSYSFGAWSKPLIFQYS
AAGRVNGYSGDLDLDLFYGSRNSWVALQ

Enzyme Prediction     

No EC number prediction in MGYG000000535_01031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	720	907	5.4e-34	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	1.12e-67	717	924	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd06525	GH25_Lyc-like	6.22e-34	718	917	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.76e-33	719	917	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.05e-25	720	907	1	179	Glycosyl hydrolases family 25.
COG5492	YjdB	3.64e-23	256	468	72	324	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR66532.1	0.0	1	928	1	928
CBK80688.1	1.39e-63	717	926	3	204
QIE78206.1	1.13e-57	717	926	3	201
QIL49850.1	1.14e-56	717	925	3	200
BBP07345.1	1.42e-55	717	926	3	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	8.90e-13	717	917	20	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	4.02e-12	717	917	20	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	2.71e-11	717	927	5	212	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZM8_A	2.62e-07	719	911	4	197	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	3.59e-11	717	917	9	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	4.22e-10	717	927	82	289	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P00721	4.11e-08	717	913	2	203	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008413	0.321700	0.666633	0.001989	0.000818	0.000423

TMHMM  Annotations     

start	end
12	34