CAZyme Information: MGYG000000535_01522

Basic Information

• Species: Olsenella sp900538935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp900538935
• CAZyme ID: MGYG000000535_01522
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		31203.18	5.5661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000535	2249918	MAG	Fiji	Oceania

• Gene Location: Start: 14722; End: 15543 Strand: -

Full Sequence      

MEQGGLGFDYKWDMGWMHDTLSYFQLDPYFRSGNYHKLSFSMMYFRNERYLLPLSHDEVV
HGKATIAQKMWGENDLKFPQARSLYCYMMVHPGKKLNFMGSEVAQLREWDERRKQDWFMR
KFPKHDAFYRFCTDLNHLYLDHPALWQEDYAEHGFQWLDVASTERCTYAIERRCAAKADT
GAGALVREKDGGAGSQPAAGERVVAVLNLSGATQEDYEVEVPGATRAEVLLDSDWDAYAG
TTPRGAEAVALDAGTHVLTCTLPPFATVILRVE

Enzyme Prediction     

EC	2.4.1.18

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	6.59e-94	2	273	470	724	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	3.41e-87	2	273	374	628	1,4-alpha-glucan branching protein GlgB.
cd11322	AmyAc_Glg_BE	2.10e-82	2	141	263	402	Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme). The glycogen branching enzyme catalyzes the third step of glycogen biosynthesis by the cleavage of an alpha-(1,4)-glucosidic linkage and the formation a new alpha-(1,6)-branch by subsequent transfer of cleaved oligosaccharide. They are part of a group called branching enzymes which catalyze the formation of alpha-1,6 branch points in either glycogen or starch. This group includes proteins from bacteria, eukaryotes, and archaea. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR01515	branching_enzym	8.49e-74	2	271	366	618	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0296	GlgB	1.23e-66	2	272	369	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR64952.1	2.15e-181	1	272	352	622
AKT49978.1	4.94e-113	2	273	359	607
QUC03914.1	1.58e-112	2	273	351	599
QBF75938.1	2.29e-89	3	273	351	595
QRO35728.1	2.29e-89	3	273	351	595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	4.67e-52	4	273	522	774	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	6.44e-52	4	273	522	774	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
6KLF_A	9.16e-52	4	273	498	750	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]
5GR0_A	1.22e-51	4	273	522	774	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.22e-51	4	273	522	774	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KD78	3.84e-57	2	273	489	742	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=glgB PE=3 SV=1
Q88FN1	9.48e-57	2	271	483	734	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=glgB PE=3 SV=1
Q4KCQ3	5.24e-56	2	271	489	740	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=glgB PE=3 SV=1
Q0BU54	6.48e-55	3	273	480	733	1,4-alpha-glucan branching enzyme GlgB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=glgB PE=3 SV=1
Q1MBS9	6.55e-55	1	273	483	734	1,4-alpha-glucan branching enzyme GlgB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=glgB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000535_01522.