CAZyme Information: MGYG000000536_00732

Basic Information

• Species: Cetobacterium_A sp900766645
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Cetobacterium_A; Cetobacterium_A sp900766645
• CAZyme ID: MGYG000000536_00732
• CAZy Family: CBM50
• CAZyme Description: Mannosylglucosyl-3-phosphoglycerate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000000536_32|CGC1	55909.06	6.3623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000536	2326188	MAG	Fiji	Oceania

• Gene Location: Start: 12781; End: 14334 Strand: +

Full Sequence      

MNRKVKVLGLMGLVLALSACTALQPKDGEYELTLVHVNDVHGRAKEGKYDGVGLARVATI
AKALEQDKNNGKVMLVDAGDTLHGTTFATLTKGESMVEVLNAAGFDYMTLGNHDFNYGSE
RLGELIDLGKYKTLAANVIEKSTGTPIGESYDIVRIDGKKVGFFGLATPETYYKTNPKNV
EDIKILDPITTAKAVVEQMQKQGVQFIVAITHLGDDESTALKLQSTGLAEAVPQINLIID
GHSHTKLEEKKMVNGVTIVQTGEYSKNVGVVKVDLDKLKDRASSIDYTLYTKEVILNGDH
PVQEDPVVKAKMDEISAKQKMITDVKVGESPILLQGDRAYVRTGETNLAQLITDSMIWKT
GADVAITNGGGIRASINPGEVTVGDVISVLPFGNYVITKEITGANLQKAVEHGLREYPNS
LGGMAQIAGMTVKFNVKNPAYRRVLEIKVGDKKLDPNKVYTVATNDFMAAGGDGYSSLAT
GKEVAHYGGLDEVLIEYIQQVGIEGRETVKPRLLPKK

Enzyme Prediction     

No EC number prediction in MGYG000000536_00732.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0737	UshA	1.35e-115	6	502	1	499	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family [Nucleotide transport and metabolism, Defense mechanisms].
PRK09419	PRK09419	1.51e-112	21	517	650	1151	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09558	ushA	7.71e-109	1	502	1	535	bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed
cd07408	MPP_SA0022_N	2.98e-66	33	286	2	252	Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain. SA0022 is an uncharacterized Staphylococcus aureus UshA-like protein with two putative domains, an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. SA0022 also contains a putative C-terminal cell wall anchor domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
cd00845	MPP_UshA_N_like	4.40e-63	32	277	1	240	Escherichia coli UshA-like family, N-terminal metallophosphatase domain. This family includes the bacterial enzyme UshA, and related enzymes including SoxB, CpdB, YhcR, and CD73. All members have a similar domain architecture which includes an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY79959.1	3.03e-145	31	509	38	510
AGF93428.1	3.98e-139	29	512	28	489
QZY54554.1	2.69e-137	29	502	31	492
AGA59602.1	3.81e-132	7	515	16	510
AEI45885.1	2.32e-128	18	502	39	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z1A_A	5.59e-67	28	509	26	530	Crystalstructure of 5'-nucleotidase precursor from Thermus thermophilus HB8 [Thermus thermophilus HB8]
1HP1_A	2.28e-60	26	500	3	498	5'-Nucleotidase(Open Form) Complex With Atp [Escherichia coli]
1HO5_A	1.06e-58	26	500	3	507	5'-Nucleotidase(E. Coli) In Complex With Adenosine And Phosphate [Escherichia coli],1HO5_B 5'-Nucleotidase (E. Coli) In Complex With Adenosine And Phosphate [Escherichia coli],1HPU_A 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_B 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_C 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_D 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli]
1OID_A	1.71e-58	26	500	3	507	5'-Nucleotidase(E. coli) with an Engineered Disulfide Bridge (S228C, P513C) [Escherichia coli],1OID_B 5'-Nucleotidase (E. coli) with an Engineered Disulfide Bridge (S228C, P513C) [Escherichia coli],1OIE_A 5'-Nucleotidase (E. coli) with an Engineered Disulfide Bridge (S228C, P513C) [Escherichia coli]
1USH_A	1.76e-58	26	500	28	532	5'-NucleotidaseFrom E. Coli [Escherichia coli K-12],2USH_A 5'-Nucleotidase From E. Coli [Escherichia coli K-12],2USH_B 5'-Nucleotidase From E. Coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9BJC1	2.29e-75	28	514	20	497	Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) OX=403833 GN=mggB PE=1 SV=1
O34313	1.18e-71	25	517	662	1182	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1
Q56878	4.74e-61	26	500	28	532	Protein UshA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=ushA PE=3 SV=3
Q9RN37	1.31e-59	12	500	7	532	Protein UshA OS=Salmonella pullorum OX=605 GN=ushA PE=3 SV=1
P06196	3.53e-59	12	500	7	532	Silent protein UshA(0) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=ushA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000536_00732.