CAZyme Information: MGYG000000536_01157

Basic Information

• Species: Cetobacterium_A sp900766645
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Cetobacterium_A; Cetobacterium_A sp900766645
• CAZyme ID: MGYG000000536_01157
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		41016.25	9.352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000536	2326188	MAG	Fiji	Oceania

• Gene Location: Start: 6111; End: 7181 Strand: +

Full Sequence      

MKIFVSTGEVSGDLHLSYLVKKAKEENPKVEFIGVAGRHSESVGVEVIQDINELAVMGFA
EAIKKYSFLKNKANEYLEFIKKENIKKVIMVDYGGFNLKFLELLKKEIKDIEVFYYIPPK
LWIWGEKRIKKLRLADHIMVIFPWEVDFYKKHNIDAVYFGNPFVEKYIPVKEKGENILLL
PGSRKQEIQSLLPEMLKVVKGNESKHYLLKLSSKEHLKWIEEDLSAYKNLKVNYDLSLKE
AVEKSCIAIAASGTVTLELALLGLPTIVVYKTSSLNYFIAKYILKVGYISLPNLTLNEEV
FPELIQKKCNGNEIEIKMKEILSNLEVVNKNIERIREKLSGDDITKRYAEFLLKGK

Enzyme Prediction     

No EC number prediction in MGYG000000536_01157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	336	5.7e-100	0.9745762711864406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	2.94e-111	1	354	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	6.50e-89	1	342	2	362	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	9.68e-76	3	336	1	353	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.85e-68	3	337	8	360	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.39e-54	1	325	2	332	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19865.1	1.10e-179	1	355	1	355
BBA50470.1	7.30e-171	1	355	1	355
VEH39859.1	1.47e-170	1	355	1	355
AVQ31390.1	1.47e-170	1	355	1	355
SQJ09670.1	2.96e-170	1	355	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.21e-36	1	324	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.18e-35	1	324	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	5.88e-53	2	353	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	4.36e-48	2	322	11	350	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
C0QR27	5.20e-48	2	352	3	373	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
Q3JAC1	1.23e-47	3	326	8	346	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
B2V704	1.25e-47	2	352	3	379	Lipid-A-disaccharide synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) OX=436114 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000536_01157.