CAZyme Information: MGYG000000537_01104

Basic Information

• Species: UMGS1826 sp900555435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826; UMGS1826 sp900555435
• CAZyme ID: MGYG000000537_01104
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000537_18|CGC1	44164.82	5.9318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000537	2340074	MAG	Fiji	Oceania

• Gene Location: Start: 20719; End: 21879 Strand: +

Full Sequence      

MDQRKFDTLNASPLNFSETDLWMGMIPASPDGKQLRRMGYTREPRAIEFRPGGVEFNVYA
PGAESVEISGTRNTRMGEEKRSLHKTEREGWWQAVISGIPGGVQFLYYFFDGKEHLYEHA
PICYAHNRLCNFVDVPDPEFDFYDFKDVPHGAVRCEYYRSSYTGTLRNCWVYTPPGYEEN
LDKRYPVLYLLHGGGENETGWIWQGKINLIMDNLLAQGKCKEMLVVMNFGHAYAPGTQQQ
GVLPGQIDQLLIRDCIPFIEGRFRVHTDKAHRAIAGLSMGSFQTQWTAFNNPDYFDYIGV
FSGVVGNAFPEVSTEGFTTAENSETFNSQHKLLFFSRGMLEGGEKLPGELKALTDNGIRV
EYFLCDGVHEWQTWRKSVHAFLQRLF

Enzyme Prediction     

No EC number prediction in MGYG000000537_01104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	161	383	2.3e-50	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.90e-25	144	386	60	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0627	FrmB	4.25e-14	170	385	38	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	4.22e-13	160	385	16	258	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
pfam00756	Esterase	3.40e-12	160	377	1	238	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	3.82e-08	52	136	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24063.1	1.05e-75	45	386	436	778
VCV24180.1	6.46e-75	50	386	442	770
CBL10138.1	6.46e-75	50	386	442	770
CBL13365.1	6.68e-75	50	386	444	772
QIA09957.1	1.60e-66	54	386	26	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	2.97e-63	52	386	23	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	3.05e-63	52	386	23	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.42e-61	54	386	48	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	8.92e-58	54	386	50	381	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6MOT_A	4.21e-56	54	386	27	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	3.49e-45	50	386	333	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.77e-40	10	386	331	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	3.28e-31	54	386	49	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	1.43e-27	148	383	46	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	6.64e-11	159	338	831	1015	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000537_01104.