CAZyme Information: MGYG000000537_01874

Basic Information

• Species: UMGS1826 sp900555435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826; UMGS1826 sp900555435
• CAZyme ID: MGYG000000537_01874
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	MGYG000000537_52|CGC1	96937.06	4.503

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000537	2340074	MAG	Fiji	Oceania

• Gene Location: Start: 3453; End: 6065 Strand: -

Full Sequence      

MRNRFRKFVSLFMALTVTSTLLSTSPALAVDAEPSVTLVNNGQATASIVVSASASQTETA
LAAELASYMQQISGVEIPVGTEASAGDSVNIYVGSASPAAEENNQAIAEAAAAENKESDC
DAYRLLVEAGAIHLNGLTDRGIQYAGYELLEQIGVRWYMPGEYGTVIPKLDTVVVKEQDT
VSVPDFYGRHMASIDGYQKTGGQPTGINYTEGRDWARYNRVNQVTYGREGWPNVQITNDL
KLPGSNFLDVTNPDALEAVVAGAIVELKKGVKVVNMGPRDGVVNAPFNPDWDVKDQIDPA
NGVLSMSDRYVRFFNKVLERLAEEGYPDAKIAFFAYSNYKNPPVATKCNERLIPVLANIT
MDRMHAIGNELSWERNQNAELLAGWREAGASPMIYQYLYNLADPGTPFSMINQVAAEYKY
YKDVGVPSIRSEVLPAWGYHGPSLYLASKMMWDADLDVDALMNEYFTTFYGPAAEAMQMH
FNILEAAYANADYFAGSCYEIPKILTSASYVEKQKENAGQHEEDKSARDELKDAIERYQR
ELREQIEKKLQEYRDKHQEQSNKIKDKIKDFFGKIFGGGHSNAAATNEAAQTEDTADARI
EQALTSLIEELPESVIEALRVTLEAAEEIAANQEDPVYAERIKTVRLAFDFGENFLGMME
SMTDFNFVEANQKYEKALEIREKSVLHSPVAINPFASYCYIDWFWKNYAPQAAERVTNGN
TMLTEMPDEWNAMLYPSGYGDVIGLQKPGLGTKSWMKLKTYSDTWSTQGLRYYKGYMWYR
TTVKVPESTGNGNVFLWLGMVDDEARVWVNGKACPKVQGASLMKPFEYDITDAVRFGEEN
LVVVEVRNAWLDELGTGGLMGPSMIWQAAK

Enzyme Prediction     

No EC number prediction in MGYG000000537_01874.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	248	478	3.1e-31	0.8804780876494024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	1.46e-32	251	477	37	259	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
PRK10150	PRK10150	1.49e-09	761	848	51	136	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	5.30e-09	760	852	50	138	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK05759	PRK05759	7.62e-06	512	629	35	135	F0F1 ATP synthase subunit B; Validated
cd06503	ATP-synt_Fo_b	4.55e-05	522	629	40	130	F-type ATP synthase, membrane subunit b. Membrane subunit b is a component of the Fo complex of FoF1-ATP synthase. The F-type ATP synthases (FoF1-ATPase) consist of two structural domains: the F1 (assembly factor one) complex containing the soluble catalytic core, and the Fo (oligomycin sensitive factor) complex containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. F1 is composed of alpha (or A), beta (B), gamma (C), delta (D) and epsilon (E) subunits with a stoichiometry of 3:3:1:1:1, while Fo consists of the three subunits a, b, and c (1:2:10-14). An oligomeric ring of 10-14 c subunits (c-ring) make up the Fo rotor. The flux of protons through the ATPase channel (Fo) drives the rotation of the c-ring, which in turn is coupled to the rotation of the F1 complex gamma subunit rotor due to the permanent binding between the gamma and epsilon subunits of F1 and the c-ring of Fo. The F-ATP synthases are primarily found in the inner membranes of eukaryotic mitochondria, in the thylakoid membranes of chloroplasts or in the plasma membranes of bacteria. The F-ATP synthases are the primary producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). Alternatively, under conditions of low driving force, ATP synthases function as ATPases, thus generating a transmembrane proton or Na(+) gradient at the expense of energy derived from ATP hydrolysis. This group also includes F-ATP synthase that has also been found in the archaea Candidatus Methanoperedens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58589.1	6.31e-217	33	867	31	769
QNK58588.1	9.89e-208	31	867	47	784
BBI32737.1	2.31e-187	36	869	64	785
QNE22644.1	2.13e-83	118	865	120	758
QDU22041.1	3.30e-51	21	868	11	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ECA_A	3.20e-07	716	848	33	163	Lactobacillusrhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999020	0.000172	0.000215	0.000171	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000537_01874.