CAZyme Information: MGYG000000538_00496

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_00496
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000000538_2|CGC2	59422.15	8.2062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 157757; End: 159319 Strand: +

Full Sequence      

MSIGKNQKLDPLTREFTEKHPDTCAAVTATAEQKLRYGVVGLFLLFLLMYRCDLFVLLVC
GVMMLLYSGAVLIRLTAAIRSLSRRSMEHVSADEIANDDLPVYTILVPLYREPEVAEKIV
KRIAALDYPPEKLDVKLLLESDDELTFRELKRTELPSGFTVLRIADAQPKTKPRACNFGL
REAKGEFCVIYDAEDIPDPDQLRKAVAVFRRDSEKRLACVQAKLNYYNSRQNWLTGFFTV
EYTAYFDLMLSGWQKFRIPLPLGGTSNHFRTAYLRELGGWDPFNVTEDCELGLRIYEKRW
STAVLDSTTLEEANSRLWNWMRQRSRWVKGFIQTHLAHYRNPLVTIRRLGLRGAAGGYMA
VGGASLMMLTNLIYWPLTLFYLFLFFHGLSAGETAGSLLAASPERENLYRGVELCGVTWK
VWPMLYTGEGEDPFWAILSQVFCAGSLFLFLSNFLLVGVHVAAVVKRGFFHLIPHALLMP
FYWVLISLGAWKGFLQIFTKPFYWEKTLHGLDAAFQKEAE

Enzyme Prediction     

No EC number prediction in MGYG000000538_00496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	103	329	9.8e-30	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	9.58e-143	101	342	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	3.61e-47	62	376	12	329	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.30e-42	105	288	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.61e-27	101	331	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	2.31e-26	101	334	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44806.1	1.04e-210	7	511	6	512
ABL80246.1	2.70e-122	65	512	198	602
AEW05577.1	4.93e-119	67	511	312	714
AEJ40069.1	4.93e-119	67	511	312	714
ANH37163.1	1.41e-117	10	512	247	706

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.33e-08	98	351	125	392	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.38e-08	98	351	137	404	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.38e-08	98	351	138	405	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.20e-19	99	330	47	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q7PC76	1.11e-13	77	346	53	339	Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA1 PE=1 SV=1
Q7PC69	2.69e-13	85	333	234	499	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
Q9SJA2	4.46e-13	88	333	212	465	Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=CSLC8 PE=2 SV=1
Q9ZQB9	1.38e-12	100	333	240	479	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999907	0.000072	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
35	50
55	77
355	377
434	456
469	491