CAZyme Information: MGYG000000538_00818

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_00818
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000000538_3|CGC3	37398.69	9.8578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 205498; End: 206523 Strand: +

Full Sequence      

MSRFLIVKPSSLGDVIHAFPAVSLLAEREPDAVIDWLVVPAFAPMVAYHPAVDNIILFRR
KELGQAAKFPKAFAELLSGIRRNRYDAVIDLQGLFRSAVVSRLARTRVVAGPLHTREWGA
RIFYRHTLNSGETERHAVRKNVAMMAEFLGIPEPENIKFELKSNSLAAQRVATLLRGFAK
EKVIAVAPGARWITKEWPPEFFAETLNLFCRDHHDYSFVILGSPSEKPLGERLRSALKAP
SLNLIGLTGIAELVEAIRRSRLLLCNDSGPMHIAAALGTPLTALFGPTDPVLTGPFSDRA
EVLTAPVDCVKCFKRECAGSGCHAAISAAAVKKSMEKMLGL

Enzyme Prediction     

No EC number prediction in MGYG000000538_00818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	319	8.5e-60	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.01e-67	3	338	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.03e-63	1	333	1	324	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02193	heptsyl_trn_I	1.74e-51	3	305	1	300	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	1.80e-51	80	317	8	241	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	2.00e-46	3	340	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43682.1	1.08e-66	1	317	81	396
QSH41947.1	1.35e-64	1	317	9	329
CBK42726.1	1.42e-60	3	339	7	338
QOV90040.1	5.93e-58	3	339	12	338
QBH13806.1	1.42e-57	3	341	2	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	5.45e-28	3	306	2	300	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.45e-28	3	306	2	300	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	6.26e-28	3	306	2	300	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	1.16e-17	3	303	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	7.38e-17	12	303	19	305	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	2.63e-27	3	306	2	300	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	1.69e-24	3	306	2	300	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P45042	3.65e-24	3	303	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q57336	6.85e-20	6	304	13	300	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	4.51e-19	3	303	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_00818.