CAZyme Information: MGYG000000538_00953

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_00953
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		50051.99	6.8095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 74153; End: 75436 Strand: -

Full Sequence      

MLNIHNYPDITFPGNFIWGSATAAHQIEGDDIHSINWRDQTEHPERFIHHSGKACDSYRL
YKEDVELLKSLGHQAYRFSIPWSRIEPEEGNFCQEAVDHYIDLLRLLKEAGIKTFVTLSH
GSDPAWFWDKGGFGDRNALHYFERYVDFIVPKLEKNVDYWMTVNEINIMQRPGCDTFDLR
KNYMICHGRAYRIIKKYSAKPVGAPHAVAAIVPKDPHFEGDKAHAAMEDWILNGFFYHAL
RTGELVIPRYEAETFPELKDSFDFWAINYYTRHEVSSRTKNGGAELLTYQQLKLIDKEFY
MSSFYPEGLYNELQRLKDKPVYITENGCCCDDDRWRIVKMCQDLSAIRDAMNSGVDIRGV
LHWSLMDNYEWVSFIPRFGMVHVDFKTFKRTPKPSSQFFKEIIKHNGFTPAMVDKYLPEL
PKFKLFK

Enzyme Prediction     

No EC number prediction in MGYG000000538_00953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	407	7.3e-104	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	5.92e-92	11	410	3	457	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	9.15e-92	10	408	3	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.60e-58	11	402	4	462	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	4.51e-38	12	414	28	485	beta-glucosidase
PLN02998	PLN02998	7.82e-36	12	404	31	486	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	9.97e-152	1	425	1	419
ADW18818.1	7.93e-145	1	421	1	430
QCX34294.1	3.68e-117	1	421	1	422
ADQ08048.1	6.12e-117	1	427	1	430
QNM13665.1	1.25e-104	1	424	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	1.23e-75	10	407	9	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	3.10e-73	10	420	3	421	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6IER_A	1.93e-54	9	396	29	421	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6JFP_A	1.93e-54	10	407	2	442	Crystalstructure of the beta-glucosidase Bgl15 [uncultured bacterium],6JFP_B Crystal structure of the beta-glucosidase Bgl15 [uncultured bacterium]
7E5J_A	3.77e-54	10	403	4	441	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22073	4.21e-53	12	406	6	442	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
P26208	3.13e-52	10	408	4	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	2.70e-51	9	407	2	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
Q03506	1.33e-49	12	403	6	443	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P22505	1.78e-49	12	408	8	448	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_00953.