CAZyme Information: MGYG000000538_01075

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_01075
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		64482.44	9.8429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 217990; End: 219723 Strand: +

Full Sequence      

MKLLKPYGILWILAAFYILAYLTPLACRPMLRPDEYRYAEIPREMLETGDWVTPKMLGVR
YFEKPAPGYQLTAVSFSLFGENAFALRLPSALASLLTAVLIFLLARTFSRDRAFAFLSAG
IFLTFGLVFGVGTFAVLDMQLTAALTGAVVFGFLAWHSRKKLWKEVVFLVCAGVFAGVAF
LIKGGLGVVIPAIVLVPFLMFRREWKRILIYGATALGAAALVALPWSLAIHEAEPDFWRY
FLEEEHWKRFTSATYDRKPQPFWYFIPVLFSGMLPAGLLWFAGWTGWKKRFSVSAPLLEK
TRIALRSLLIESPALSFLFCWFVIPFVFFSASSCKLGTYILPCFPPLAMLTADGVCAAFR
TNRASAQKWLNGMLRWFGGAVLALSALALSGLVIMKLTDFLIFGGSFWLQVTTALLLFAW
GCLVWRSAKEKHNLRKMALFLFGITPAVITALASLTPEQFGSRATGDAIRMCLKDMPVNA
DDLVLVDRNTATAAGWVLKSSDLIVIGKPGEMQYGFLNYPEYASRWYQEKDLEQLVRMTP
PGKRVWIMIERGDPKPLPAAIPDAEIHHADGVTAARF

Enzyme Prediction     

No EC number prediction in MGYG000000538_01075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	533	1.2e-103	0.9203703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	4.51e-111	10	537	8	508	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	7.23e-46	1	543	1	524	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	4.78e-14	12	241	7	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.18e-11	64	209	2	139	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1287	Stt3	3.20e-05	65	211	96	244	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42095.1	2.41e-108	13	577	8	549
AVM46372.1	2.12e-98	12	555	6	529
QTF09713.1	5.41e-88	11	566	8	536
VEA65444.1	2.22e-87	12	560	11	536
QDW33282.1	4.37e-87	1	565	1	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.33e-38	18	466	42	466	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	1.38e-85	12	565	13	536	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
Q66A06	1.61e-83	1	565	1	537	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1
A7FHH6	1.61e-83	1	565	1	537	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=arnT PE=3 SV=1
Q1CIH9	1.61e-83	1	565	1	537	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
A9R091	1.61e-83	1	565	1	537	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.369422	0.149043	0.479651	0.000410	0.000370	0.001106

TMHMM  Annotations     

start	end
7	26
83	105
114	136
141	158
165	182
186	201
208	230
262	284
305	327
337	359
372	394
404	426
439	461