CAZyme Information: MGYG000000538_01557

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_01557
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		54729.42	5.6902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 81163; End: 82596 Strand: -

Full Sequence      

MPETVHYTENSRPFRRELVPELIYDANPALVDFYYLAWKQAWEHIYETESLPFSPYIGEG
CKRDRIWIWDSCLMGMFCRYAADVYPVCSTLDNLYALRDGRSGYPINIHHLDNPPLFAWT
ELLLYRQTGDEARLKKILPVLISHYNWLENLDPDRMPYQAERPVWRRERDGYCWAGCPSG
MDNTPRGRGRYDAIHWVDAPAQQALSARCIAEIGAIAGDRAAMEHFEREYAEKTALLAKY
FDPETGCFLDRYRDGSGFCRVLTPASFWVLAAHCATREQAESQIRSLLDPRKLGGDFPFA
SVAHDDPDFRPEGAYWRGGIWLPVAYMSVKACEEYGRFELAAELAKRLVEMMERTFREFS
PHTIWECYSPTAYRPSTNKVNELVRQDFCGWSALGPIALMIENVVGLVRMDAAEQRIEWL
PGGSGRMGMKNLPLGGNRISLVLENDRISVDCIQPFRLIFRGRELACPAGRSGIEII

Enzyme Prediction     

No EC number prediction in MGYG000000538_01557.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	1.92e-12	113	394	156	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	2.99e-12	114	348	419	739	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.00e-10	114	359	180	466	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.16e-09	112	407	339	610	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK13270	treF	5.14e-07	147	392	296	535	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93173.1	1.69e-122	15	476	28	498
AVM44762.1	3.56e-117	16	474	96	593
SDU91719.1	3.98e-116	11	470	4	476
QZT38129.1	2.34e-114	20	472	33	498
AOW82330.1	3.48e-114	13	476	39	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.67e-13	135	409	512	804	Crystalstructure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
3W7S_A	5.13e-06	114	345	392	709	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	5.13e-06	114	345	392	709	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	5.13e-06	114	345	392	709	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	2.91e-27	56	442	46	428	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P53008	1.63e-12	135	406	542	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000055	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_01557.