CAZyme Information: MGYG000000538_02078

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_02078
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1017		114717.72	9.2543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 146833; End: 149886 Strand: +

Full Sequence      

MKKLFMLLALGTVSLLQAETFTLSPDGQRNWKSPLYEIPASRPPMQIHYKTTTTGQIGHG
VMLQWYDKEGRHLGSFMPRPPFHYPVDALFNKPIERVQTVLPFAYPADAAKVQLTISTSD
FQKRFPKAGKAGKTVFADPEIRWVRRVVAEQPLNWFDMTGPVVFNADLPEDAVGVRGIVK
NSDGVKVADITVKGERWAWETPRLGFYAVQFFFIGKDGTQSPVEESFYLTTHFNEQGMPV
RYQSEKTFTRNVQSFAVTEKRVRADREHPFGLNVARENEHQAYFTPMSDSLDISWLCGTN
SFIRWHAANWDRIEAKKRGEYDWSDVDSYFAKAKAGGYDESRILLNTFGTPRWNSPKPEN
TAIWFSRYCFFAPKDLSAWGDYLKAFAKRYPKIRLWELWNEPHLPGGSVFWRESSPEQFV
ELMKTGYEALKSVNPENIVIQGGIGMRYIPFYDAETKLGVQRYYDLLGTHCVYSYEQFEE
VNRKYNAPKRGYIETEWHTTLYNCNAPVLPTEEDLCFRMILQLAQMLNMNVERIAAFNPF
TGNHLPETARYFAKAGGIQQVSGLFRSVPFKEPRLPALALRTATDRFAGKVKPLGACYFG
DGIQQAAFFASDRGNVAFFWSQDGKGKLTLTSEAAALLKGRTVLDWEGRKVSPENLLARR
VYFVLDADPAILKLGKPMKEISPKPRLPELEKFVSGKYAPLANPEWNEVKTYVSANGKPK
AEGFSARFAADLNANGLDLVAEVKDAAHRPDCKELMLWEADSLQFSIDSVGKGDFSDVIE
YAVGKNGVIFKAKAPVLNGDIPADYSEAGVPLKKSRAEISRKDGATVYRIHVSNGDLYPF
VRRENQPLRFSLLVNNNDGAGREGWLEWSTGIGGIKAAHRFGTLHPKASKPEGKFSQPRI
FQSGTLTKKDGVIRLESVAGNEKKGAAGISCSVLDCTPGSKYRVTFLARGKGNLEGMVWG
HALKRTNISRLPLSSEWREFSADIEVPETETSLALAVFFWHQTDVHFELKDLKIKEK

Enzyme Prediction     

No EC number prediction in MGYG000000538_02078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	308	471	3.6e-22	0.39675174013921116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	8.08e-25	724	884	28	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	1.50e-05	717	868	11	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	4.29e-05	373	435	121	189	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45582.1	1.33e-136	154	1015	32	916
BBH24554.1	2.34e-92	22	884	257	1135
AVM45605.1	1.31e-86	27	886	230	1093
BBH20281.1	2.96e-83	154	901	223	991
AHF94113.1	1.25e-76	168	886	247	984

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.49e-10	309	486	55	224	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.49e-10	309	486	55	224	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.998990	0.000204	0.000190	0.000172	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_02078.