CAZyme Information: MGYG000000539_00099

Basic Information

• Species: Oribacterium sp004554245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sp004554245
• CAZyme ID: MGYG000000539_00099
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000000539_1|CGC1	40275.35	6.7138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000539	2303957	MAG	Fiji	Oceania

• Gene Location: Start: 122051; End: 123157 Strand: -

Full Sequence      

MLTVSKSENAASHSDRIHALYNKEGTAADHGTASASFPNIQSAVDAADAAYKEACRRGVS
WTGETIRISKGIYHERVTITTPGLTLRGEGAKETIISYGLYGFMPSPDIGKLGTFRSYTM
LIDADQVILRDLGIENTAGAGPDIGQAIALYADGDELRFDSIALLGWQDTLFTGPLPPKE
IEKNGFIGPKQFAPRRNGRQYYRNCHIEGDIDFIFGSATAFFDHCTLLQKDRRKLLRPAA
DLRAGAEALSFATAASTPKGQAYGYVFDHCRFLSDCPDASCYLGRPWRNFAHVAVLHSWL
GPQIHPAGFHNWGKTEAEGSVRFCEYQNEGPGAVPSQRASFVKELSDEAAVEYALEKVVP
FAVKKEKV

Enzyme Prediction     

No EC number prediction in MGYG000000539_00099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	33	358	1e-77	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.05e-66	21	360	81	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	7.05e-50	34	353	9	289	Pectinesterase.
PLN02773	PLN02773	1.89e-49	34	350	14	287	pectinesterase
PLN02682	PLN02682	8.43e-40	33	350	78	352	pectinesterase family protein
PLN02432	PLN02432	8.15e-38	37	353	23	280	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	1.50e-98	64	358	30	312
ABX41678.1	1.06e-96	65	358	36	330
AMC07926.1	1.48e-94	34	358	9	308
QIX89293.1	1.37e-93	66	358	47	339
ANU50094.1	1.56e-92	66	358	47	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.41e-26	60	365	29	296	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	9.77e-26	36	352	18	282	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	9.77e-26	36	352	18	282	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.36e-24	66	358	37	333	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	5.49e-22	60	341	33	281	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.03e-37	34	350	14	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	8.23e-33	66	353	288	545	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O23447	1.55e-30	66	354	422	680	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
O23038	8.65e-30	36	347	100	370	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q8L7Q7	2.38e-29	26	355	290	588	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000097	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000539_00099.