CAZyme Information: MGYG000000539_00761

Basic Information

• Species: Oribacterium sp004554245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sp004554245
• CAZyme ID: MGYG000000539_00761
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1232	MGYG000000539_9|CGC2	141819.44	5.4012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000539	2303957	MAG	Fiji	Oceania

• Gene Location: Start: 53849; End: 57547 Strand: +

Full Sequence      

MDFSRHITNTIEWFYFEDVTSGRERDASVLVLGDKETTAPFVTLLEPRVHQVSRRLDDST
YDYVVIPVLTKKILRLFQGDVHTMLQALTETWLKKGGRILMGIENALDIDRMASSDRKED
ILYLRWSELASLRATLREEQPGARETLYYLTPELSVPLHFYSDARMPDVSEEDEKTALLI
RENRFREFAPAYFYIYQPDASVRPKARDYRRFLPDYIKYNSTRKPEYAIKTLLYRDDQGK
RFAVKAGTTPAANAHIESLSEKAEAIAAANPQLTVLRAVETSRALGSYQFLSFIRYPFVE
GQSLSEILRDMIKDGVAPIRELAESVDLVLGAKDGSVQPANFDCQFDNVIMSADRPTLID
CEWVFEEAVDVRFLQYRILYYWYMEYREFLAYEDALAFLRNFGFSKPELDAFAEREQSFQ
EEVHGQDGERMHAFLNDRVTVKRFRALEEEYTKTLHDAQELQREVKERDITIQKEREVNR
LTQVHVANLTNVIQVHERDIQSLIAERDYYMARQSLKARVGTRLRNSLNHHFPVGSRKRK
VLSYVKRTLRHPAKMLPMYFTEDGKNRIRGDFNVGDLYASYGKVKFERSDAPLVSIVIPC
YNQIHYTYQCLISIKEHTDFAATPYEVIIADDVSTDATREIGQYAENLVVARNRENMGFL
KNCNQAASIARGKYIFFLNNDTQVQEGWLASLVELIERDESIGMVGSKLVYPDGRLQEAG
GIIWSDGSGWNYGRLQDPADPEYNYVKEVDFISGAAIMIRTELWKEIGGFDERFAPAYYE
DTDLAFEVRKHGKKVMFQPKSVVIHFEGISNGTDTSDTSSLKHYQVVNQEKFREKWAAEL
REQCVNDGNPNPFDARERGQHRPCMLMIDHYVPTWDKDAGSKLDYQYMQLFLRQGWRVKF
LGDNFAHEEPYTSALEQLGIEVLYGAKLQADIWGWIERNSAFIRIAYLSRPHIAARYIDY
IRDHTDMKIIYHGSDLHSLRLMREYAIDHNEKTREEAEYWHGVEYAVMRKADMSYFPSEV
EAEIVHKEDPTIHVKAITSFVYDAPAVLDEDYAKKQDLLFVGGFAHPPNKDGLLWFVKDI
LPQIEAEIPGVVLHVIGSHADDEVLALNARPDVDVLGFVSIEKLDEMYRRSRVVVVPLRF
GAGVKGKVVEALHAGTAVVTTSCGAEGIPAAETALRIEDDPTAFAQEVIHLYRHPEEIEQ
MAHNAVSFITTFYSPEGAWAKIKDDFETGRNV

Enzyme Prediction     

No EC number prediction in MGYG000000539_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	595	760	5.9e-25	0.9470588235294117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.87e-48	596	807	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.01e-47	592	812	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13692	Glyco_trans_1_4	3.36e-24	1055	1194	1	138	Glycosyl transferases group 1.
COG1215	BcsA	1.03e-23	585	803	47	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd02525	Succinoglycan_BP_ExoA	1.71e-23	593	806	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21849.1	0.0	58	1226	115	1313
ASN93838.1	0.0	58	1226	115	1313
QRP41495.1	0.0	58	1226	115	1313
QIX92521.1	0.0	91	1226	141	1314
ANU46567.1	0.0	91	1226	141	1314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S22_A	6.26e-09	585	842	175	447	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.46e-17	574	835	608	875	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.02e-14	583	814	565	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q48455	7.12e-11	1057	1222	212	384	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q8MYY6	2.00e-09	625	805	143	340	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2
P9WMY2	6.92e-09	624	841	32	273	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000539_00761.