CAZyme Information: MGYG000000539_00792

Basic Information

• Species: Oribacterium sp004554245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sp004554245
• CAZyme ID: MGYG000000539_00792
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		97314.78	4.8955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000539	2303957	MAG	Fiji	Oceania

• Gene Location: Start: 35948; End: 38521 Strand: +

Full Sequence      

MLRFKVDIALAREGELMLQGWAFGSNPEEEVKLTVVDQTGNPVPGTTVSSVCRDEVVTAF
FGDYVKAHGALHRDLGFDVHTPYAQGETRILVLQADGQMKRVKFTDHILEEFNSVAHRKR
EKLLALFQWETVEVAWEYFQKHGLRALFKKSVHKIQNIQDDYDYNEWYKKVRITDEELAK
QRESVADFAQQPTFSIVIPVYATPEKFLRRMLDSIRVQTYPNFEVCLVDATPYAKIQHDP
TQGRTPQEVLAEYAAADSRFRYETLAENLGIAENTNAAIRMATGDFIVLADHDDELEPQA
LYECVRAIDAHPDVQVLYSDEDKIDFEDIYYFEPHFKTDFNPDLLRSVNYICHLFVARRS
LLDAIAETDADGRKIYERSAYDGAQDYDLILRATEKAQAMERERIAAAYMPTVNADVLQA
CTDAQQADTVQAMPSCASELRGLDPLDQELLRQGRFTSSNIIHIPMVLYHWRAHQASTAQ
HPEAKLYAFEAGARAVYDHCKRIGLPIEKVEQGITYGFYHPIYKNQQPLISVVIPNKDHT
ADLDQAITSLAAGKYKNLEFIIVENNSDQPETWKYYEELKNRFPEELPADFCDPVQASAD
HSTAASVLPQPVVKVVKWDGPFNYSAINNYGVRFTHGQYLLFLNNDIEEIDPDSIDEMIG
YVQREDVGICGARLLYPDEDIQHAGVIMGMGGIAGAAFVRTHDSDLSYMHRAKCIQDYSC
VTAACLLTKRSLFDAVGGFTEKLAVAFNDVDYCMKVRALGKLVVYNPYAKFYHYESKSRG
MEDTPEKLARFHSEILTFGTTWKDILRDGDPYYSPALTFRKANFALKDLTQEQVGEPMHY
ALLKGIVWDGPDAGTQS

Enzyme Prediction     

No EC number prediction in MGYG000000539_00792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	195	362	3.2e-23	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.69e-81	192	473	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	9.87e-31	532	775	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	6.68e-26	195	362	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	2.52e-23	528	792	3	236	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	4.09e-21	196	337	1	135	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91353.1	1.11e-274	2	837	1	723
CBL36811.1	2.22e-273	2	837	1	723
CBK76130.1	2.22e-273	2	837	1	723
ASN97860.1	4.75e-271	2	837	1	723
QRP37330.1	4.75e-271	2	837	1	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.34e-08	195	316	8	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	9.26e-108	180	826	346	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.03e-75	182	827	309	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.58e-09	191	319	7	126	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000539_00792.