CAZyme Information: MGYG000000541_01193

Basic Information

• Species: Bruticola sp004554425
• Lineage: Bacteria; Eremiobacterota; Xenobia; Xenobiales; Xenobiaceae; Bruticola; Bruticola sp004554425
• CAZyme ID: MGYG000000541_01193
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35120.8	9.4201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000541	2312271	MAG	Fiji	Oceania

• Gene Location: Start: 1537; End: 2487 Strand: +

Full Sequence      

MNMIKDSFNNLYLSCLGHEFSWKTKTTSRMVCWAVVFLLGLWTWAPACADEIRAEVRTVN
GQKEVFYTNAANDSFMHGSTYPTYQGKRRSSSAKKATASKTKTSAARAAKSSATAKAAPQ
GKRRPDGTYEFAPPQYKVYEVKPRYAYKDDWSFATFDPGKRQPRLVSYYGWDPNDPQQKQ
RAWVEVDLNPIILKYAKIWGVDPLLVEIVICHESGFNPNAVSPVGAVGLMQLMPATASGL
GVYDAFDVEQNIAGGTRYIASQLERFNSVPLALAAYNAGPGAVMQYGGVPPYSETQYYVD
TIYGEYLAGKRAREGR

Enzyme Prediction     

No EC number prediction in MGYG000000541_01193.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	203	308	7.6e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	4.82e-43	203	306	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.41e-39	190	299	8	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	5.03e-36	191	300	7	138	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.63e-34	192	288	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.55e-33	192	285	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS92357.1	8.04e-39	177	308	39	168
BAB06571.1	9.80e-38	161	307	73	230
AEE96658.1	1.36e-37	187	302	88	203
QHS22538.1	1.87e-37	187	308	84	206
ARK31455.1	3.57e-37	186	307	93	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.51e-11	140	302	360	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.51e-11	140	302	356	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.52e-11	140	302	366	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.53e-11	140	302	370	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.54e-11	140	302	376	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.07e-34	185	308	57	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	6.19e-32	196	306	1430	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.19e-32	196	306	1430	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.60e-15	199	279	18	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	2.66e-13	189	312	287	434	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.146985	0.758860	0.092747	0.000465	0.000403	0.000522

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000541_01193.