CAZyme Information: MGYG000000543_01036

Basic Information

• Species: Agathobacter sp900552085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900552085
• CAZyme ID: MGYG000000543_01036
• CAZy Family: GH13
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000543_6|CGC1	44925.63	4.7842

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000543	2969366	MAG	Fiji	Oceania

• Gene Location: Start: 79419; End: 80648 Strand: -

Full Sequence      

MSADDFCINKLVPGYFSRINEDGSYSNGSGCGNDTASERNMVRKYIVDSVCYWADEYHMD
GFRFDLVGLLDTDTINEIVEEVHKTHPDVIFYGEGWTMETGVTKDNVTMATQGNSASTPD
FAFFNDNIRDGLKGSVFDTATFGFVSGATNAEKKMADSFMANESWCKEPSQIINYASCHD
NNTLFDRIAGSKTTSSEEDIIKMNNLAAAFYMTAEGVPFLQAGEEMLRTKVNDDGTFNSN
SYNAGDEVNSIKWDTLSDKKYADVFEYYKGLIKFRKAHPALRLSTSEDVKKYVKSVEGLG
NNIVGINIKGGQKDESAKEMYLLFNANTDKAKVTIPEGKWKVCINGQKAGVETIETIKGG
EYTMDGISALVLVKQDGASMTIVIVLIAAAVVVAAGVVIVVMKKKKTNK

Enzyme Prediction     

EC	3.2.1.1	3.2.1.41

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	4	225	2.9e-69	0.6955017301038062

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	9.26e-139	10	352	264	604	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	1.20e-136	1	275	133	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	5.37e-73	6	375	300	692	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02102	pullulan_Gpos	1.40e-44	11	379	589	1010	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.
PLN02877	PLN02877	3.44e-40	7	294	502	870	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35847.1	8.57e-176	2	374	494	868
BBF44596.1	1.34e-121	6	375	281	649
BCN30228.1	9.57e-110	3	375	278	653
VCV21250.1	7.67e-108	5	376	269	652
CBL13024.1	2.56e-106	5	376	272	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAN_A	2.28e-81	9	372	566	919	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]
7LSA_A	2.00e-76	3	377	330	716	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	2.84e-75	3	377	330	716	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	2.93e-75	3	377	330	716	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	2.97e-75	3	377	330	716	ChainA, Pullulanase [Ruminococcus bromii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	2.40e-86	9	375	479	843	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	2.70e-64	10	336	351	673	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
A0A0H2ZL64	2.12e-33	11	379	710	1131	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
Q9F930	2.14e-33	11	379	732	1153	Pullulanase A OS=Streptococcus pneumoniae OX=1313 GN=spuA PE=1 SV=1
A0A0H2UNG0	2.88e-33	11	379	725	1146	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999232	0.000687	0.000045	0.000005	0.000002	0.000041

TMHMM  Annotations     

start	end
379	401