CAZyme Information: MGYG000000544_01599

Basic Information

• Species: Zag1 sp900769355
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900769355
• CAZyme ID: MGYG000000544_01599
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		76379.04	9.1351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000544	1985493	MAG	Fiji	Oceania

• Gene Location: Start: 1624; End: 3609 Strand: +

Full Sequence      

MFDWEMKKKIAFVAATLVVVAGSCFAMFYQSPAKTDEIYKAALEDFSKGDYQNAYYLFSK
ISYFSNLKPIAIYHRGECAMMLGDSKSEIKQYQFLFNNYPHNKLSVRARYLAGQKLVETN
PQSAKKYFEYIIHNAPDTDYAIASEYYLGVILQNKYKSVKIIPTSAKDDVQNYYRHYLTK
SPAGRHALRAVEHWLEFADNINKDDYLLMANSCYQLGEYEKAREILQKTDVNENWTLDVK
NSYAMKNYPRAKFLTENGVQKRSQYVKDDEIIDAIDIYVKLSDSKERAVERLLGLSSGKG
RDYLLNLKCQNSPQNEKVACYSNLYLKYPDGRFSADALSNIFFAKIKSGDLTNARKIGMD
HLKKFPDANSSPMVMFWLGKIAEKTNNYSEYTSYYKSVINKYPDSYYAYRAYLKLSRMQG
PLITSSIKPQPVVYPYKYTRNNIIVKLVDLKDFDVVNEMCADDDFVKSWALYQKGDYSHS
MLVARDAMEKIKNKPDKFDLRWRLVYPVIFYDDVVKYAGQTGNSAPLMLSLIREESYFDP
LAQSAVGASGLMQLMPSTASEINAKMGLGMNVSSALFNPYKNIKLGNYYYLFLKRNLEGY
DISSIAAYNGGIGSIQRWKNSLHYNDTDEFVEQIPYSETQNYVKKVFRTYWNYVRIYDGN
S

Enzyme Prediction     

No EC number prediction in MGYG000000544_01599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	521	652	2.4e-24	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.60e-52	506	653	2	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	7.53e-38	507	650	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.22e-27	527	651	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.13e-26	374	660	24	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	1.52e-23	506	646	475	617	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	0.0	1	661	1	661
BAZ44929.1	8.58e-42	197	658	203	685
BAQ62516.1	1.91e-41	45	657	96	711
AKV69146.1	6.41e-41	67	658	118	708
QHU83802.1	8.66e-41	67	658	118	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.00e-20	500	646	406	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.06e-20	500	646	410	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.14e-20	500	646	416	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.19e-20	500	646	420	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.27e-20	500	646	426	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.25e-16	506	661	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.25e-16	506	661	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.03e-15	506	661	476	632	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	2.05e-13	514	651	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	5.95e-12	511	646	428	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.436725	0.036762	0.521449	0.000311	0.000244	0.004513

TMHMM  Annotations     

start	end
12	29