CAZyme Information: MGYG000000545_00802

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000000545_00802
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000000545_12|CGC1	53603.75	5.0267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000545	2021811	MAG	Fiji	Oceania

• Gene Location: Start: 26147; End: 27550 Strand: -

Full Sequence      

MFPENFLWGGAVAANQCEGAYNDDGKGLSIQDVMPQGIKGPRTEQPTEENLKLIGIDFYH
RYKEDIKLFAEMGFKVFRLSIAWSRIFPKGDETKPNEAGLAFYDKVFDECHKYGIEPLVT
LSHYETPLYLAEHYDGWINPKMIGFYLNYVKVVFERYKDKVKYWLTFNEINSILNSPFMS
GGIATPKEELTESQLYQAIHHEMVASAAAVKLGHEINPECKIGCMILSMPVYPLSPDPND
VIKAMEESHQHDMFTEIHVRGEYPGYMKRYMREHNIEVKFAPGDEEILKNTVDFISFSYY
VSVCATADEEKNIRGEGNLLGGVPNPTLKASEWGWQIDPQGLRYILNYFWDKYRKPLFIV
ENGLGARDQLVDDGKGGKTVNDDYRIEYMRDHLLQVEEALEDGVEIMGYTSWGCIDLVSA
STAQLSKRYGFIYVDRNDDGSGSLKRYKKKSFDWYKHVIETNGEALH

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	463	9.4e-153	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	2	466	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	467	3	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	466	6	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	2	466	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	466	4	473	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV35751.1	7.14e-279	2	466	5	469
BCG60908.1	1.44e-278	2	466	5	469
AKN30150.1	1.90e-278	2	466	5	469
QUL54135.1	8.95e-278	2	466	5	468
AIQ76460.1	1.61e-277	2	466	5	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	2.36e-245	1	466	19	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	2.97e-213	2	466	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.18e-179	3	466	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.23e-179	3	466	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	1.49e-177	2	466	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	2.85e-261	2	466	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	1.82e-216	2	466	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	1.32e-205	2	466	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	2.19e-203	2	466	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	1.78e-196	2	466	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000545_00802.