CAZyme Information: MGYG000000546_00518

Basic Information

• Species: Roseburia sp003483745
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003483745
• CAZyme ID: MGYG000000546_00518
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000546_12|CGC1	91921.99	4.9615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000546	3035642	MAG	Fiji	Oceania

• Gene Location: Start: 19960; End: 22404 Strand: -

Full Sequence      

MKFGYFDDANKEYVITSPKTPLPWINYLGSENFFSLISNTCGGYSFYKDAKLLRLTRYRY
NNVPLDSNGHYYYIKDGDTIWNPGWMPTKTELDAYSCRHGMGYSVFKGTKNKLTAELTSF
VPVGETCEVGKLSLTNENNETRNFSVFSYVEFCLWNAMDDMTNFQRNFSTGEVEIHGSAL
YHKTEYRERRNHYAVYAVNAPIAGFDTDRDSFLGAYGENSAPEVVVNGTSKNSVASGWAP
IGSHHLEVSLAPGETKTYVFVLGYVENPVEEKWVGRAEDGVINRKRADELLSRFDTAEKA
DAALAKLKDYWNELLSHFTVSSSEEKLDRMVNIWHQYQCMVTFNMSRSASYFESGIGRGM
GFRDSCQDLLGFVHLIPDRARERILDIAATQFEDGSAYHQYQPLTKKGNSDIGSGFNDDP
LWLIAGTAAYIKETGDYTILDEMTPYDSDASKATTFMEHLRRSFHYTMEHLGPHNLPLIG
RADWNDCLNLNCFSTEPGESFQTFGPSEGPNAESVFIAGMFVRYGKDYAAICRHQGMTEE
AEIAEKAIAEMEKTVMDAGWDGEWYLRAYDHYKNKIGSKECEDGKIFIEPQGFCVMAEIG
LEEGYCLKAMESVEKYLDTKYGIVLLQPPYHRYHVELGEISSYPPGYKENAGIFCHNNPW
ISIAETVVGRGNRAWQVYTRTCPAYIEDISEIHRTEPYVYSQMIAGKDAPNFGEAKNSWL
TGTAAWTFLDVSQFILGIRPDYDGLTVDPCIPSKLDGFTAKRDFRGVSYHITVKNPNHVE
KGVVSMIVDGQPVEGNTIPFSAEKKEVNVEVTMG

Enzyme Prediction     

EC	2.4.1.20	2.4.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	2	811	0	0.7461389961389961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	0.0	310	739	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11754	GH94N_CBP_like	0.0	1	306	1	303	N-terminal domain of cellobiose phosphorylase (CBP) and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20) or cellobiose:phosphate alpha-D-glucosyltransferase, or CepA. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Cellobiose phosphorylase participates in the degradation of cellulose, it catalyzes the phosphate dependent hydrolysis of cellobiose into alpha-D-glucose-1-phosphate and D-glucose, a reversible reaction.
COG3459	COG3459	0.0	1	812	271	1051	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam06165	Glyco_transf_36	1.75e-105	21	263	1	247	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.
cd11755	GH94N_ChBP_like	1.18e-102	1	306	1	300	N-terminal domain of chitobiose phosphorylase (ChBP) and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes chitobiose phosphorylase (EC:2.4.1.-). This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Chitobiose phosphorylase catalyzes the reversible phosphate dependent hydrolysis of chitobiose [(GlcNAc)2] into alpha-GlcNAc-1-phosphate and GlcNAc. In some organisms, ChBP may be involved in the production of GlcNac-6-phosphate in intracellular pathways.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV20975.1	0.0	1	814	1	814
CBL11091.1	0.0	1	814	8	821
CBL09808.1	0.0	1	814	1	814
AEN95786.1	0.0	1	814	1	821
CBK91117.1	0.0	1	814	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CQS_A	0.0	1	813	21	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3S4C_A	0.0	1	813	1	822	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3RRS_A	0.0	1	813	1	822	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3QDE_A	0.0	1	814	1	811	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3ACS_A	0.0	1	813	21	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	0.0	1	814	1	813	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.27e-154	1	814	1	801	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	1.36e-153	1	805	1	794	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
P20471	9.54e-73	3	786	2052	2818	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q7S0S2	1.74e-40	69	777	84	757	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000546_00518.