CAZyme Information: MGYG000000546_01520

Basic Information

• Species: Roseburia sp003483745
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003483745
• CAZyme ID: MGYG000000546_01520
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000546_60|CGC1	94384.02	5.9639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000546	3035642	MAG	Fiji	Oceania

• Gene Location: Start: 13441; End: 15885 Strand: +

Full Sequence      

MNTHKFMVEEIRFHLSIPDTLIFVGWYYDGTTKNHTLKVSLDGKELPVEQLINKGVEVCQ
KYIHSVNEISEEVVGIIKLPENWKEGHKLLIESAYKGDWHKEASYSVAKLKTFENKIIYS
VDNVRRTEDKLIVNGWCVGSGEIKLSLLDGKKQPMNAKSNHFYREDEEHVSPDDEKREKL
FFTIQSDRVDEKVFYLEMRGPKSVARMRLDKWHNDSGLAGILGKAQKAFRFLKRNGIKAT
LVRINERLGQNKGLIYEHWLEKYGIKEEELQKQREKQKEFSYRPLFSVAVPLYKTEERFL
RELIQSVQNQTYDNWELCLADGSEDGGEGLTSIVEEYQKNDPRIRYRVLEKNYGIAQNMN
EAMHMAKGEFVTPVDHDDTLTPDALYEFVKALNEHPSVEVLYSDEDKIDTDGTKYFEPHF
KADYDVDFLLTNNYICHLFAVKCSMESYQEGFLSEFDGSQDFDFILRCCEEAKEIYHVPK
VLYHWRCHFDSTAANPQSKLYAFEAGRRAAEAHYKRLNIPATVEHAQFYGLYRTRYNWEK
KPAVTVLIPNRDHVEDLKRCIDAVLCSDYCNYEIVVVEHNSKDQQTFAYYEKLQKECSRA
RVLTYTGEENISKIYNFAVKAVSGEYLLLLDPLTQMINTSFMSEMLGYCMREDVGIVGAK
LIYEDDTIAHAGIVLGFGGAFGYVFRGKSRYIAGYESRVICAQDYSAVSGVCMMVKRSVY
EEAGGMTEEFSNRFHDIDFCLKARKAGWLVVYNPYAEGYYYGTKEAAVPVVEGRTKDNRE
AELLVKKWETEIKAGDPYYNPNLTLDRMDFSLRR

Enzyme Prediction     

No EC number prediction in MGYG000000546_01520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	287	399	1.3e-26	0.6470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.40e-90	284	487	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.16e-31	546	762	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.67e-27	287	444	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.59e-24	297	488	10	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.89e-22	288	439	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97498.1	4.34e-317	1	814	1	817
CBL08067.1	1.63e-305	1	814	1	829
VCV23342.1	1.63e-305	1	814	1	829
QUO33456.1	2.13e-217	4	813	3	811
QBE99396.1	2.48e-214	1	814	1	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	8.95e-08	284	403	1	124	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.36e-108	284	812	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.85e-64	281	814	316	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	2.21e-13	284	506	4	230	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q58457	3.88e-13	283	468	7	194	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P77414	8.76e-12	284	478	5	207	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000546_01520.