CAZyme Information: MGYG000000546_02457

Basic Information

• Species: Roseburia sp003483745
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003483745
• CAZyme ID: MGYG000000546_02457
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MGYG000000546_164|CGC1	73641.49	6.2351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000546	3035642	MAG	Fiji	Oceania

• Gene Location: Start: 3210; End: 5108 Strand: +

Full Sequence      

MANFSELDRYLFGQATHYEIYRKLGAHFTDQYGIRGVCFDVWAPNAARIWVIGSFNGWDE
TADEMKRLEPDTMGIFELFIPGIEEGALYKYLIETKDGKRLYKADPYANYAELRPGTASA
VTDIEHFKWTDEKWMEERANTKDVYAKPMAIYEVHPGSWKRHPGREDDGFYGYRDLVKYL
IPYVKEMGYTHIELMGISEYPFDGSWGYQVTGYYAPTSRYGTPEDFAYFVNECHKHKISV
VLDWVPAHFPKDAHGLAEFDGTCLYEYADPRKGEHPDWGTKIFDYGKNEVKNFLIGSALM
WIEHYHIDGLRVDAVASMLYLDYGKQPGQWIPNKYGDNKNLEAVEFFKHVNTLILGRNPG
AVMIAEESTAWPKVTGRVEDDGLNFSYKWNMGWMHDFLDYMKLDPYFRKDNHHKMTFAMS
YNESEKYILVLSHDEVVHLKCSMINKMPGEMEDKFKNLMVGYAFMMGHPGKKLLFMGQEF
AQLQEWSEARELDWYLLENPAHQHMQNWVKKLLHIYQKNPALYELDSSWGGFEWINANDA
ERSIFSFIRKSKNGKNNLLFVCNFTPVERKDYRVGVPKHKTYKLILNSEDAEFGGNGKER
PVSYKSVPQECDGRPYSFAYPLPGFGVAVFRY

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	182	482	2.1e-152	0.9966777408637874
CBM48	23	110	2e-17	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	1	632	4	627	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	6	630	605	1220	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	6	632	8	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14706	PRK14706	0.0	24	632	27	621	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	5	631	101	722	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV23983.1	0.0	1	632	1	632
CBL10287.1	0.0	1	632	1	632
CBL13518.1	0.0	1	632	1	632
AEN98279.1	0.0	1	632	1	633
CBK91812.1	0.0	1	632	1	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GR5_A	1.11e-226	8	631	133	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	4.45e-226	8	631	133	772	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	8.92e-226	8	631	133	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	8.92e-226	8	631	133	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.26e-225	8	631	133	772	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	1.15e-311	5	630	8	630	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
Q7NL20	8.63e-237	5	631	104	727	1,4-alpha-glucan branching enzyme GlgB OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glgB PE=3 SV=1
Q8DLB8	1.30e-236	5	631	107	749	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q1AZ86	1.11e-234	5	631	100	718	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q11EX1	2.50e-232	2	629	111	733	1,4-alpha-glucan branching enzyme GlgB OS=Chelativorans sp. (strain BNC1) OX=266779 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000546_02457.