CAZyme Information: MGYG000000548_00190

Basic Information

• Species: Sutterella sp900770335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900770335
• CAZyme ID: MGYG000000548_00190
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000548_3|CGC1	35633.04	8.4905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000548	2283169	MAG	Fiji	Oceania

• Gene Location: Start: 17493; End: 18497 Strand: +

Full Sequence      

MTTPERILIIKSSSMGDIIHALPVAHDIRRAFPQARIDWVAEESFRDIPTLAPAVANVRV
TAFRRWRKSILSGATRVEVAALRAELEAEHYDCVLDIQGLMRSALVARWTGVPSIGYTWG
TIREPLASLAYARHLNLPESLGAVRRYRMAAAEALGYSIDPDRPVFGLRASGTPPARAAG
RTVSFAVNTSRDEKLWPEARWIELGLALLAEGLTPILYWGGAAEEARAKRIALAIPGAIV
APRARLSDVAAGLAQASLMVGVDTGLAHLAAALGCPSVGIFVATPTETLRLIGDGPCESL
GGRGRCPSPAEALEAAHRVMAAAEAGRDAKESDK

Enzyme Prediction     

No EC number prediction in MGYG000000548_00190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	81	287	1.4e-35	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02193	heptsyl_trn_I	6.91e-103	6	319	1	318	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	7.29e-75	6	284	2	282	lipopolysaccharide heptosyltransferase RfaC.
COG0859	RfaF	3.11e-57	4	318	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.80e-37	6	318	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.68e-37	79	294	1	222	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54731.1	1.44e-175	1	321	1	321
QQS89702.1	1.13e-160	5	321	2	318
BBF22155.1	3.41e-128	6	322	2	318
QNM96908.1	1.71e-82	6	316	3	312
QDC48452.1	1.06e-81	5	311	11	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	7.66e-57	6	284	2	282	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	7.66e-57	6	284	2	282	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	9.50e-57	6	284	2	282	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	4.42e-57	6	313	2	304	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	5.60e-54	6	284	2	282	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000548_00190.