CAZyme Information: MGYG000000548_00894

Basic Information

• Species: Sutterella sp900770335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900770335
• CAZyme ID: MGYG000000548_00894
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000000548_24|CGC1	33004.49	9.1884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000548	2283169	MAG	Fiji	Oceania

• Gene Location: Start: 117; End: 1022 Strand: -

Full Sequence      

MALPGLRLLEASGVTPILTGKRWAEDLLAGTGWRFEPIEGHVTEDFTRIRNIARYYGPNP
RGLLFPNSMSSAVLYWIGGIRSAGFPTDCRRLFLEKSIEEPGQMHEVERFFTLAHRALEA
WDIKPAWDKVPPSLGLVPLKRHEAAARNLMESLGIPERFALLAPVARGLHHGKKKHWEHF
NELCAPLREMGIEPVVFPAVREIELVKAVCPDAKICPPTTLGTLAALAKKAVVVIANDSG
MSHVAAAVGATQITLIGVTTPQRTGPWNPKATVLGNEGTWPTLSEVVDKIKIIKGTAINF
L

Enzyme Prediction     

No EC number prediction in MGYG000000548_00894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	66	275	3e-32	0.8177777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	1.97e-34	61	277	15	230	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	6.28e-18	65	273	88	294	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	9.82e-18	115	275	86	241	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	1.29e-09	61	273	82	294	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.59e-08	147	267	173	299	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55160.1	3.10e-177	1	291	17	307
QQS89241.1	2.52e-168	1	293	19	312
BBF22597.1	5.94e-126	1	290	18	307
ANU65198.1	4.20e-102	1	290	17	305
QQQ96353.1	4.20e-102	1	290	17	305

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	3.90e-08	63	274	84	305	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000053	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000548_00894.