CAZyme Information: MGYG000000548_01099

Basic Information

• Species: Sutterella sp900770335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900770335
• CAZyme ID: MGYG000000548_01099
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44045.66	7.2343

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000548	2283169	MAG	Fiji	Oceania

• Gene Location: Start: 2322; End: 3503 Strand: +

Full Sequence      

MGTQSNHPAQDTHGIAWLAGEASGDYIASLALPEVEKRFEGAAQYGIGGERMRAAGLDAW
HDIRELSVRGYVEVLAHLPRLLRLRSEIVRRISASDPRVFVGVDAPDFNLGVEQQLRRRG
VPVVHYVSPSIWAWRPERIHQIRRSVDHMLLVFPFEREIYRRAGIEATFVGHPLASVIPM
EPDVEGARRDFGLAEDSLPVVTVMPGSRLDEVKGCAPAFFGAVEQLLHTHGDMHVLIPAA
DEQARERIIFIAGRYPRLAQRMIVRIGTSHRMIEAADAVLVASGTATLECALYKKPMVVG
YSMPALTGILMQRKALIRHVSLPNILMGENVVPEFLQYFCQADQIAHALEYALDDDARRR
ELAERFGRLHESLRADTSSLVADVLEKHARRRW

Enzyme Prediction     

No EC number prediction in MGYG000000548_01099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	15	374	1e-117	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.56e-151	15	392	4	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.75e-136	15	379	4	368	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.70e-102	15	375	1	372	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.64e-91	14	386	7	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	2.70e-44	19	336	233	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54177.1	9.02e-246	1	393	1	393
QQS88891.1	4.03e-228	1	393	1	392
BBF22932.1	4.86e-204	1	392	1	391
ANU65980.1	5.41e-131	15	387	9	383
QQQ97139.1	5.41e-131	15	387	9	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.62e-77	15	385	9	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.37e-77	15	385	9	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2T5I1	1.46e-112	15	387	10	384	Lipid-A-disaccharide synthase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=lpxB PE=3 SV=1
Q13XC9	4.13e-112	15	391	10	388	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
B2JIB3	2.16e-109	15	385	10	378	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
Q1LNE5	2.54e-108	15	385	23	391	Lipid-A-disaccharide synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=lpxB PE=3 SV=1
Q63T25	9.54e-108	15	387	10	380	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000016	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000548_01099.