CAZyme Information: MGYG000000549_00331

Basic Information

• Species: Zag1 sp001765415
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp001765415
• CAZyme ID: MGYG000000549_00331
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666		76540.81	9.0909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000549	1845545	MAG	Fiji	Oceania

• Gene Location: Start: 317881; End: 319881 Strand: -

Full Sequence      

MSLSKILDKIITKICHKENTTKNTYNLQELFSYKATINLENKVDIIIPIYNGYDYLTNLF
DGIKSNTDLNYRLIVINDKSSDLRVLPLLNSYQEIFGSKMLLVNNEENLGFVKTINKGLS
LAKENVIILNSDVIVPKNWTSRLLEPIIKNDKVASVTPFSNAATIFSLPQNNFDNDFNED
LEQVNNKIQNINLPAGSLKFPTGVGFCMAMNKKTIKEIGGLDEIFEKGYAEENDWCQRAI
KRGYINTIAPNLFVWHKHGGSFNNKEKQDLLKSHLKILKKRYPNYSKSIKNLLKDGKYLS
IRFWAELLYINAVAKTTEIWFDHICGGGTETYTFNKINELKNETLIIRIQNGWNNNFTIS
YYYKEYKNKIIINSLFDIEVMLKQLIPDLIVVNNLATYKNIYETLNFIKKIKSDIGTKIS
FRAHDLQFICPSIRMINSEHKYCYCTDTKICQNCFKQFKKLPISIDNIEEWQKNWFNFLN
DIVDEIIVFSNSTKKILLTFCPNTENKISVIPHSVTPLRKVTIEKHDKINICILGKITID
KGALIIKEIDKLLPQYPKLNIKVLGNVKGSIRRHLKNVKVLGKYKVANLSNLIEKEQIDI
VFIPSVWPETFSYTTAEAMSMGLPVACFDIGAPAERVKENNSGCVINNIDAKDALDTILQ
YFEQNL

Enzyme Prediction     

No EC number prediction in MGYG000000549_00331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	218	1.3e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.56e-25	45	258	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.74e-23	42	305	4	261	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd03823	GT4_ExpE7-like	7.10e-20	359	656	72	316	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03801	GT4_PimA-like	1.51e-19	483	659	141	331	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd00761	Glyco_tranf_GTA_type	9.70e-17	45	163	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38833.1	0.0	1	666	1	666
BBK78212.1	2.37e-146	40	664	164	788
QMW89726.1	2.37e-146	40	664	164	788
AEE14041.1	6.72e-126	37	664	221	864
BAS49353.1	6.67e-124	43	660	786	1413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57287	6.19e-06	43	156	7	119	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000036	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000549_00331.