CAZyme Information: MGYG000000549_01207

Basic Information

• Species: Zag1 sp001765415
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp001765415
• CAZyme ID: MGYG000000549_01207
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42573.99	9.5025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000549	1845545	MAG	Fiji	Oceania

• Gene Location: Start: 99088; End: 100212 Strand: +

Full Sequence      

MKKLFIITGEYSGDIHASHVVEALKAAHPDIEIEGVGGENLRRVGVKLFSDQKKMGAVGL
SFKIVADHLMLGKRVVDYLTKEYKPDLVLLIDYGVFNLNISKFLHRAGIKVFYYIPPQVW
ASRKWRINTIKKNVDEVLCIFPFEKEMYESYGIKTHYCGHPLVSQLPKKADRDEFFEKHG
FDKNKKLVSIFPGSRVFELKYLMNVFIKSALDLQKKHPDLQFCISHAPNLSDSVYNKFLK
KTPFPVIKGENQALLSVSDALILASGTVALEACLYQTPMLIAYRGPWLFYFIYLIVRCIK
RVSLPNIIANKSIVPEIIQGDVCVQKISYKIEELLFDKNYRAKNIAELGEVKSLLSDKVS
SKEAANVIVEALYN

Enzyme Prediction     

No EC number prediction in MGYG000000549_01207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	1.5e-104	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.09e-118	1	372	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.05e-102	1	370	1	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.03e-74	4	335	1	339	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.05e-70	6	368	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.40e-38	1	327	1	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	6.30e-273	1	374	1	374
ABG58662.1	6.18e-74	3	372	2	367
AEG01383.1	2.74e-73	9	372	15	381
QMU61387.1	4.81e-72	4	372	13	384
QPK65076.1	1.96e-71	9	372	15	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.40e-44	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.54e-44	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.47e-67	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	8.38e-67	3	372	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B6J161	7.42e-66	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	1.04e-65	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.04e-65	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000549_01207.