CAZyme Information: MGYG000000550_00398

Basic Information

• Species: Lawsonibacter sp900545895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Lawsonibacter; Lawsonibacter sp900545895
• CAZyme ID: MGYG000000550_00398
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39079.15	4.243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000550	2679456	MAG	China	Asia

• Gene Location: Start: 27762; End: 28832 Strand: -

Full Sequence      

MKHTKRAGALTLAAALSLSMALPAGAASYTVQKGDSLWKIAKEQLGSGTQWNRIYEANQN
AIRDPNLIYVGQQLTIPGTEQTKSNPNTNTDTDKEEPAMTNIEKATALIRTFATGDTETA
ARLLDENYIQHNLAYGTGEAAFLGSVEYLASAPVKTTVNNIRAFEDGDYVFLQTVYNFAG
AGEQVAFDIFRFDEDGEIAEHWDNLAALADQPNPSGRTQIDGAMEITDLDKTEENRQLVK
NFLYDVMQGNNPEKTADYFDGDTYLQHNTAIADGVSGLNAALSALAQQGIQMIYDETHMV
LAQGNYVLAVSEGTYGGAPTSYYDLWRVENGKIAEHWDVMETIADPSTWQNRNGKF

Enzyme Prediction     

No EC number prediction in MGYG000000550_00398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	29	77	1.7e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	8.46e-17	29	77	98	146	LysM domain/BON superfamily protein; Provisional
COG4922	COG4922	3.05e-13	100	203	6	111	Predicted SnoaL-like aldol condensation-catalyzing enzyme [General function prediction only].
COG4922	COG4922	3.95e-13	229	356	1	129	Predicted SnoaL-like aldol condensation-catalyzing enzyme [General function prediction only].
NF033163	lipo_LipL71	2.80e-12	22	77	400	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	2.29e-11	28	76	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE65021.1	2.32e-20	1	76	2	77
QQQ99593.1	2.32e-20	1	76	2	77
QQL05891.1	4.77e-14	26	77	41	92
QQR03087.1	2.91e-13	1	77	1	77
ANU48020.1	2.91e-13	1	77	1	77

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.20e-07	21	77	90	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0ADE6	5.69e-07	21	77	90	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	5.69e-07	21	77	90	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
P54335	1.15e-06	28	77	160	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
O86308	1.20e-06	26	77	171	221	Resuscitation-promoting factor Rpf OS=Micrococcus luteus OX=1270 GN=rpf PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000502	0.998563	0.000207	0.000286	0.000226	0.000195

TMHMM  Annotations     

start	end
7	29