CAZyme Information: MGYG000000551_00203

Basic Information

• Species: Mailhella sp900553065
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900553065
• CAZyme ID: MGYG000000551_00203
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42013.01	8.465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000551	2226054	MAG	China	Asia

• Gene Location: Start: 101782; End: 102897 Strand: +

Full Sequence      

MKTLWINAGEISGDLQGGALLAALRDTAPELDLRVVGMGGDNLARAGQENLLRVEELSVM
GIVEVLAALPRAFRLLRRIRREMERIRPDAVLLIDAPEFNFRVAKIAHRLGIPVYYFIPP
KVWAWRTGRVEFLKKHIRRIFSILPFEVDFYRSHGMDVTYVGNPLVDLVDYEGIKDVSSV
PHRIGLMPGSRRKEVESLLPAFAGAAQKLVQRFPDLEFHCIRSSNFTEEYLRSLWNCPLP
LIMHDGSDRYRLMRTFQCIMAASGTATLETGLAGVPTLVAYKVSPLSYWIGLHVLKVKWI
SLTNLIMNRTVFPEHIEKDADPEPLAARMEDWLAHPEKLDAIIRDLDELRERCGAPGSAR
RAAEALKKELL

Enzyme Prediction     

No EC number prediction in MGYG000000551_00203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	352	2e-108	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.29e-113	1	365	1	370	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.90e-110	1	371	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.07e-89	6	368	3	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.33e-77	11	365	11	381	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.14e-53	1	368	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS95839.1	2.55e-146	3	370	4	369
ADP86417.1	2.55e-146	3	370	4	369
ABM28724.1	7.26e-146	3	370	4	369
ABB38982.1	1.50e-135	2	370	6	372
CAJ55109.1	2.93e-134	1	371	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.18e-53	3	362	8	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.19e-52	3	362	8	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	7.25e-74	2	363	4	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.40e-70	8	366	11	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	2.14e-70	4	364	12	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B3E4H8	2.78e-70	2	363	7	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	3.16e-69	4	363	9	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000551_00203.