CAZyme Information: MGYG000000551_00228

Basic Information

• Species: Mailhella sp900553065
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900553065
• CAZyme ID: MGYG000000551_00228
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000000551_3|CGC1	38662.48	8.1927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000551	2226054	MAG	China	Asia

• Gene Location: Start: 30733; End: 31761 Strand: -

Full Sequence      

MARYSSRISNKHMVVVRFSSLGDVVLTTGVLLDWHKKHGTMFTVITKEAFEPVFAGHPAV
LNVIGFDENDLHGQTQAMNFRGLMEKYRDSPLLDLHRNLRSAMLARIWRDAIICYSKMAL
ARRIFLWSKGRFFGEQLRRYNVPQRYAIGLYDKENVPAASELRPCIFLSEEEKAAAAARV
AHLRREKRPLVALHPFATHEAKSWPAETWLRLAALLRKENIDYFWVGQGQGIEEEDSSRS
FINNTGLRELFGLIHEADVLITGDSGPMHIATAVNTPVLALFGPTCREWGFFPSGEHDRV
LQLSMPCRPCSLHGSGSCNRNNACITGIEPEQVLEELKAMIS

Enzyme Prediction     

No EC number prediction in MGYG000000551_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	93	320	1.6e-43	0.8977777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.60e-42	11	342	2	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.68e-41	15	339	4	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	3.42e-19	144	340	132	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	6.56e-18	80	310	5	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.54e-09	144	342	133	344	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS96432.1	5.20e-97	8	341	3	333
ADP86511.1	5.55e-97	8	341	5	335
ABM28232.1	1.68e-95	8	341	3	333
EGB16504.1	2.09e-95	6	342	3	336
AMK12356.1	1.09e-92	14	341	11	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.33e-09	11	302	9	306	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	4.14e-09	144	341	133	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	2.85e-10	144	342	133	344	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	9.19e-10	144	341	133	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	1.63e-09	144	342	131	345	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35