CAZyme Information: MGYG000000551_01863

Basic Information

• Species: Mailhella sp900553065
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900553065
• CAZyme ID: MGYG000000551_01863
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000551_59|CGC1	41301.53	8.4801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000551	2226054	MAG	China	Asia

• Gene Location: Start: 5058; End: 6200 Strand: +

Full Sequence      

MPGRPRTIVRRFAAFFVLLLCLTGQGCAVSRRPSVEEMAGAMIMTGFHGTEAPPSVLQAI
SEGKIGGIILFERGKKPGEAYNIESPVQLKRLVDSLQNAAPRTLLVAVDQEGGQVRRLKT
TRGFSALPSAAAMGRMETSEVWNFGYRAGREMASLGINVDLAPVADIRRSRRSPGLGDAG
RLFGDDPEKVTRQALAFGDGLFQAGVLPALKHFPGLGSAGKDSHLSLPDVTDSWSRDELI
PYKTAFVGDWPGMVLVAHVYNRNFDENLPSSLSPAVVDGLLREELGWNGVVISDDLQMGA
ASKGHSLEERVRLALLAGNDILLFGNHLEYDPLLHERLFQAVMALVKEGVVPVERLKISW
RRIEAMKERLAEAQKAAASK

Enzyme Prediction     

No EC number prediction in MGYG000000551_01863.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	104	323	2.6e-44	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.54e-68	34	370	2	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	9.85e-60	34	363	1	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.76e-49	65	379	26	331	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.12e-08	49	367	60	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD90486.1	1.86e-103	4	366	8	383
QCC86050.1	3.97e-102	19	378	14	376
AAS96712.1	2.78e-100	3	373	25	397
ABM28024.1	2.78e-100	3	373	25	397
ADP87229.1	2.78e-100	3	373	25	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.08e-50	34	371	12	341	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.35e-48	29	368	3	338	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	1.13e-41	29	380	38	421	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.39e-41	29	380	12	395	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.82e-41	29	380	42	425	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.21e-41	29	380	38	421	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q0A911	1.86e-39	43	332	6	290	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
C4LEY6	1.41e-38	43	327	4	279	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
A7MFT1	1.75e-35	43	363	4	323	Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=nagZ PE=3 SV=1
D4AQ52	2.23e-35	39	371	25	352	Uncharacterized secreted glycosyl hydrolase ARB_06359 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06359 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000493	0.999544	0.000001	0.000000	0.000000

TMHMM  Annotations     

start	end
12	29