CAZyme Information: MGYG000000552_00871

Basic Information

• Species: CAG-521 sp900554675
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900554675
• CAZyme ID: MGYG000000552_00871
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44090.69	9.7571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000552	1311729	MAG	China	Asia

• Gene Location: Start: 1051; End: 2247 Strand: +

Full Sequence      

MRLMRTSLLVATVAALVAACSTTPQISEHEAAAKKLNPGQASLILEPTTFEKLPAMNDAD
WEPALTAFKESCKKMLKKEGWQGVCIAANGVAKGQAKNFFTANFVPYQTVSVKRNQDLTI
EVTDTGLMTGYYEPILYGNRKKKSPYIHPLHTMPDDLITVDLSSIYPQLKGMRLRGQIEG
NKLVPYDTRAQLDRKKKKLDQYAIAWVEDPVAAFFLQIQGSGRIVLPDGSYMRVGYGDVN
GHPYQGIGRYLVKKGYLKPYELSMQSIRAWAKKNPKKVQDVLNQNPSYVFFVERTDQKAD
EGPLGAQGVPLTEEGSVAVDRRFYEMGWPLVVDVSQANPELKFTKAVVAQDTGGAIRGPI
RYDFFWGSGDGAGEAAGRQSSQVKSWVLLPHGVKPPKK

Enzyme Prediction     

No EC number prediction in MGYG000000552_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	137	291	1.9e-58	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	2.09e-103	57	291	2	230	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
COG2821	MltA	1.47e-92	53	396	35	371	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
cd14668	mlta_B	1.40e-82	136	294	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	9.64e-73	135	291	1	152	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	1.55e-46	127	388	117	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22454.1	2.82e-152	16	395	16	390
QQS89395.1	7.48e-130	38	395	40	393
ANU66434.1	8.32e-128	10	395	13	396
QQQ97583.1	8.32e-128	10	395	13	396
QDA55021.1	3.82e-119	50	395	53	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	1.09e-79	53	393	32	362	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	5.50e-79	53	395	50	418	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
6QK4_B	1.26e-76	38	391	17	347	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
2G6G_A	1.88e-76	60	395	57	418	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
3CZB_A	1.76e-44	49	391	11	342	Crystalstructure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15],3CZB_B Crystal structure of putative transglycosylase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	1.63e-27	129	388	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	1.63e-27	129	388	119	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q8K9A7	1.60e-23	128	388	126	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1
P57531	1.38e-20	128	388	118	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000552_00871.