CAZyme Information: MGYG000000553_00603

Basic Information

• Species: Prevotella sp900548535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548535
• CAZyme ID: MGYG000000553_00603
• CAZy Family: CE6
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MGYG000000553_3|CGC3	70090.04	7.4933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000553	2921999	MAG	China	Asia

• Gene Location: Start: 133029; End: 134909 Strand: +

Full Sequence      

MKKKLLILGALLMGLTKVSAAVDPNFQIYLCFGQSNMEGNAAIEDEDRTGVDPRFMAMYA
VDDEKAGWKKGEWHIAVPPQARPSTGLTPVDYFGRKMVANLPENVKVGTITIAVGGASID
LFDKRTYKAYLKKQPDWMKQFAAGYNGNPYARLIELAKIAQKQGVIKGILLHQGETNNGD
PNWPNRVKTIYNDILKDLNLKAADVPLLVGETVQKDQGGSCWAHNAVVDSIAKTIPTAHV
ISSKGCPQRGDGLHFIAESYRTMGKRYANMMLSLLGILPDANYPRVDKDHRAYVKLHAPE
AKEVIFDICGKKYPMKKDYDGDWYGVSDPLVVGFHYYFLNVDGVQVVDPASETYYGWCRE
AGGLEVPEGDEGNYYRPQQGVAQGQVRSVSYYAASQGKFRRAMVYTPAEYETNPTKRYPV
LYLQHGMGEDETGWSHQGLMNHIMDNLIAEGKAEPMIVVMESGDVKKPFVPRPGKNVDEE
RNQYGASFYDVIIKDLIPMVDKTFRTKTDRDHRAMAGLSWGGCQTFNTVLNNMDKFSAFG
TFSGALFGVDVKTCFNGVFADADKYNSQIKYMFMGCGSEENFGTEKMAQQLKDLGIKLDV
YVSPGTHHEWLTWRRCLKEFVPHLFK

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	396	623	2.7e-56	0.960352422907489
CE6	89	199	5.2e-31	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	4.67e-38	25	273	1	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
cd02858	E_set_Esterase_N	1.35e-37	290	367	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	3.96e-26	337	626	25	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	5.41e-15	400	624	8	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	6.55e-13	397	546	20	172	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67597.1	0.0	16	626	25	635
QDH54067.1	6.76e-289	3	626	2	637
ALJ48336.1	2.74e-288	3	626	2	637
QRQ55180.1	2.74e-288	3	626	2	637
SCV07744.1	2.74e-288	3	626	2	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MOT_A	3.02e-101	281	626	16	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	6.12e-101	281	626	37	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
7B5V_A	1.52e-99	278	626	34	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	5.70e-85	279	626	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	5.88e-85	279	626	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.36e-246	23	626	43	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	7.43e-66	279	626	390	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	9.91e-34	268	626	24	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	6.20e-27	374	621	39	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	7.35e-09	404	625	845	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999069	0.000176	0.000164	0.000148	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000553_00603.