CAZyme Information: MGYG000000553_02210

Basic Information

• Species: Prevotella sp900548535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548535
• CAZyme ID: MGYG000000553_02210
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000000553_35|CGC1	36624.74	6.5983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000553	2921999	MAG	China	Asia

• Gene Location: Start: 5405; End: 6394 Strand: -

Full Sequence      

MNKLLLVIISLLAAVNISAANKYDNPDTIVVSRDGTGEFRTIDEAIEVCRAFMDYTKVIY
VKKGVYKEKLIIPSWLTNITICGEDRDNTIITWDDHANILMPIGGLDSEAAVKGKPMGTF
RTYTLKVQGTYFTLENITIENNAAKLGQAVALHLEGDHILIHNCRLLGNQDTVYTGMAGS
RIAFYDCYIEGTTDFIFGPSRAWFENCEIHSKANSYITAASTPAGQEYGYVFNKCKLTAE
PGVDKVYLGRPWRPYAATIFMNCEMGSHILAAGWDNWRNPKNEETARYAEYGNHGPGAST
KGRVAWAKQLTKKEAAKVTIMNVFGEEAW

Enzyme Prediction     

No EC number prediction in MGYG000000553_02210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	323	7.2e-103	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.14e-79	29	320	2	291	Pectinesterase.
PLN02773	PLN02773	2.67e-76	31	317	9	289	pectinesterase
PLN02682	PLN02682	7.49e-72	19	315	61	352	pectinesterase family protein
COG4677	PemB	8.90e-70	26	324	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	3.99e-68	29	329	13	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66521.1	1.57e-200	1	329	1	329
BCS84477.1	2.15e-165	1	324	1	315
QVJ81978.1	3.30e-152	3	329	2	320
ADE82952.1	3.30e-152	3	329	2	320
QJR97878.1	7.77e-150	18	324	11	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.19e-42	30	323	6	294	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	6.74e-42	29	306	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.19e-34	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.32e-34	29	303	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	2.31e-33	30	328	34	362	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.15e-57	31	315	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.33e-53	18	329	74	380	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FM79	5.22e-52	29	314	82	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P41510	2.03e-49	28	329	272	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q8GXA1	2.24e-48	30	329	259	556	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999120	0.000165	0.000156	0.000149	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000553_02210.