CAZyme Information: MGYG000000554_00113

Basic Information

• Species: Campylobacter fetus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter fetus
• CAZyme ID: MGYG000000554_00113
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38481.37	8.6662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000554	1538481	MAG	China	Asia

• Gene Location: Start: 16016; End: 17047 Strand: -

Full Sequence      

MKILVSCLEASANLHLEEVLKYLGDTEICGIFDKKFGEPLYDSKEFSAMGFVEILPLIFK
AKKALKQMVKLAKNCDKVLLIDSPAFNLPLAKAIKEAGLKCKVTYYILPQVWAWKRGRAA
KVEKYCDNLASILPFDASFYSRSYYVGHPLLDEIKVQKKELLNSGVIAFLPGSRKSEITR
LMPIYKEVASSLNNKKLLVVPLNLKNDIDEIYGDVSEFQIIFDTHAALLQSEFAFVCSGT
ATLEAALIGTPFVLCYKAKAIDIWIARKLVKLKHVGLANIMFDFMDKEALNVELIQEQVS
KKALLDEYKNCDRSKFLGACGELRSYLKHGSAKIVADMVLSQN

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	311	4.3e-92	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	342	2	347	lipid-A-disaccharide synthase.
COG0763	LpxB	6.28e-104	1	340	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.75e-86	3	332	1	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.33e-79	3	336	8	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	1.06e-74	1	340	2	372	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMS67137.1	1.87e-247	1	343	1	343
QMS65244.1	1.87e-247	1	343	1	343
QMS61336.1	1.87e-247	1	343	1	343
QMS63281.1	1.87e-247	1	343	1	343
QMS58246.1	1.87e-247	1	343	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.94e-24	38	304	52	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.94e-24	38	304	52	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HWH9	5.48e-119	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
A8FK76	5.48e-119	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q9PIK8	6.29e-118	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
O25537	1.05e-102	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1
B5Z7M7	1.49e-102	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000554_00113.